KEGG   Homo sapiens (human): 9260Help
Entry
9260              CDS       T01001                                 

Gene name
PDLIM7, LMP1, LMP3
Definition
(RefSeq) PDZ and LIM domain 7
  KO
K19867  LIM domain-binding protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    9260 (PDLIM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM PDZ PDZ_6 DUF4749 PDZ_2 TF_Zn_Ribbon zinc_ribbon_10
Motif
Other DBs
NCBI-GeneID: 9260
NCBI-ProteinID: NP_005442
OMIM: 605903
HGNC: 22958
Ensembl: ENSG00000196923
Vega: OTTHUMG00000130853
Pharos: Q9NR12(Tbio)
UniProt: Q9NR12
Structure
PDB: 

Position
5q35.3
AA seq 457 aa AA seqDB search
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFG
APPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHA
YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTW
HVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcaaagtagtgctggaggggccagcaccttggggcttccggctgcaaggg
ggcaaggacttcaatgtgcccctctccatttcccggctcactcctgggggcaaagcggcg
caggccggagtggccgtgggtgactgggtgctgagcatcgatggcgagaatgcgggtagc
ctcacacacatcgaagctcagaacaagatccgggcctgcggggagcgcctcagcctgggc
ctcagcagggcccagccggttcagagcaaaccgcagaaggcctccgcccccgccgcggac
cctccgcggtacacctttgcacccagcgtctccctcaacaagacggcccggccctttggg
gcgcccccgcccgctgacagcgccccgcagcagaatggacagccgctccgaccgctggtc
ccagatgccagcaagcagcggctgatggagaacacagaggactggcggccgcggccgggg
acaggccagtcgcgttccttccgcatccttgcccacctcacaggcaccgagttcatgcaa
gacccggatgaggagcacctgaagaaatcaagccaggtgcccaggacagaagccccagcc
ccagcctcatctacaccccaggagccctggcctggccctaccgcccccagccctaccagc
cgcccgccctgggctgtggaccctgcgtttgccgagcgctatgccccggacaaaacgagc
acagtgctgacccggcacagccagccggccacgcccacgccgctgcagagccgcacctcc
attgtgcaggcagctgccggaggggtgccaggagggggcagcaacaacggcaagactccc
gtgtgtcaccagtgccacaaggtcatccggggccgctacctggtggcgctgggccacgcg
taccacccggaggagtttgtgtgtagccagtgtgggaaggtcctggaagagggtggcttc
tttgaggagaagggcgccatcttctgcccaccatgctatgacgtgcgctatgcacccagc
tgtgccaagtgcaagaagaagattacaggcgagatcatgcacgccctgaagatgacctgg
cacgtgcactgctttacctgtgctgcctgcaagacgcccatccggaacagggccttctac
atggaggagggcgtgccctattgcgagcgagactatgagaagatgtttggcacgaaatgc
catggctgtgacttcaagatcgacgctggggaccgcttcctggaggccctgggcttcagc
tggcatgacacctgcttcgtctgtgcgatatgtcagatcaacctggaaggaaagaccttc
tactccaagaaggacaggcctctctgcaagagccatgccttctctcatgtgtga

DBGET integrated database retrieval system