KEGG   Homo sapiens (human): 9260
Entry
9260              CDS       T01001                                 
Symbol
PDLIM7, LMP1, LMP3
Name
(RefSeq) PDZ and LIM domain 7
  KO
K19867  PDZ and LIM domain protein 5/6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9260 (PDLIM7)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   9260 (PDLIM7)
SSDB
Motif
Pfam: LIM PDZ PDZ_6 DUF4749 PDZ_2 Peptidase_M50 TF_Zn_Ribbon
Other DBs
NCBI-GeneID: 9260
NCBI-ProteinID: NP_005442
OMIM: 605903
HGNC: 22958
Ensembl: ENSG00000196923
Vega: OTTHUMG00000130853
Pharos: Q9NR12(Tbio)
UniProt: Q9NR12
Structure
Position
5:complement(177483394..177497604)
AA seq 457 aa
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFG
APPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHA
YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTW
HVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggattccttcaaagtagtgctggaggggccagcaccttggggcttccggctgcaaggg
ggcaaggacttcaatgtgcccctctccatttcccggctcactcctgggggcaaagcggcg
caggccggagtggccgtgggtgactgggtgctgagcatcgatggcgagaatgcgggtagc
ctcacacacatcgaagctcagaacaagatccgggcctgcggggagcgcctcagcctgggc
ctcagcagggcccagccggttcagagcaaaccgcagaaggcctccgcccccgccgcggac
cctccgcggtacacctttgcacccagcgtctccctcaacaagacggcccggccctttggg
gcgcccccgcccgctgacagcgccccgcagcagaatggacagccgctccgaccgctggtc
ccagatgccagcaagcagcggctgatggagaacacagaggactggcggccgcggccgggg
acaggccagtcgcgttccttccgcatccttgcccacctcacaggcaccgagttcatgcaa
gacccggatgaggagcacctgaagaaatcaagccaggtgcccaggacagaagccccagcc
ccagcctcatctacaccccaggagccctggcctggccctaccgcccccagccctaccagc
cgcccgccctgggctgtggaccctgcgtttgccgagcgctatgccccggacaaaacgagc
acagtgctgacccggcacagccagccggccacgcccacgccgctgcagagccgcacctcc
attgtgcaggcagctgccggaggggtgccaggagggggcagcaacaacggcaagactccc
gtgtgtcaccagtgccacaaggtcatccggggccgctacctggtggcgctgggccacgcg
taccacccggaggagtttgtgtgtagccagtgtgggaaggtcctggaagagggtggcttc
tttgaggagaagggcgccatcttctgcccaccatgctatgacgtgcgctatgcacccagc
tgtgccaagtgcaagaagaagattacaggcgagatcatgcacgccctgaagatgacctgg
cacgtgcactgctttacctgtgctgcctgcaagacgcccatccggaacagggccttctac
atggaggagggcgtgccctattgcgagcgagactatgagaagatgtttggcacgaaatgc
catggctgtgacttcaagatcgacgctggggaccgcttcctggaggccctgggcttcagc
tggcatgacacctgcttcgtctgtgcgatatgtcagatcaacctggaaggaaagaccttc
tactccaagaaggacaggcctctctgcaagagccatgccttctctcatgtgtga

DBGET integrated database retrieval system