KEGG   Homo sapiens (human): 92609Help
Entry
92609             CDS       T01001                                 

Gene name
TIMM50, MGCA9, TIM50, TIM50L
Definition
(RefSeq) translocase of inner mitochondrial membrane 50
  KO
K17496  mitochondrial import inner membrane translocase subunit TIM50
Organism
hsa  Homo sapiens (human)
Disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    92609 (TIMM50)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    92609 (TIMM50)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    92609 (TIMM50)
Transporters [BR:hsa02000]
 Other transporters
  Primary active transporters [TC:3]
   92609 (TIMM50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-GeneID: 92609
NCBI-ProteinID: NP_001001563
OMIM: 607381
HGNC: 23656
Ensembl: ENSG00000105197
Vega: OTTHUMG00000183066
Pharos: Q3ZCQ8(Tbio)
UniProt: Q3ZCQ8 A0A024R0M6
Position
19q13.2
AA seq 353 aa AA seqDB search
MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGP
SYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFK
DYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETL
FQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEH
YALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcggcagcggtgttctcgcgcttgcgaagcgggctccggctcggctcgcgg
ggactgtgcacgaggttggcgacgccgccccgccgggccccagatcaggccgcagagatc
gggagccgcgggagcactaaggcgcaagggccacagcagcagccgggctcagagggtccc
agctatgccaaaaaagttgcgctctggcttgctgggctgcttggagctggtgggactgtg
agcgtcgtctatatctttggaaacaacccggtggacgaaaatggtgccaagattcctgat
gagttcgacaatgatccaattctggtacagcagttgcgccggacatacaaatatttcaaa
gattatagacagatgatcatcgagcccaccagcccttgccttctcccagaccctctgcag
gaaccgtactaccagccaccctacacgctcgttttggagctcaccggcgtcctcttgcat
cctgagtggtcgctggccactggctggaggtttaagaagcgcccaggcatcgagaccttg
ttccagcagcttgcccctttatatgaaattgtcatctttacgtcagagactggcatgact
gcgtttccactcattgatagtgtggacccccatggcttcatctcctaccgcctattccgg
gacgccacaagatacatggatggacaccatgtaaaggatatttcatgtctgaatcgggac
ccagctcgagtagtagttgtggactgcaagaaggaagccttccgcctgcagccctataac
ggcgttgccctgcggccctgggacggcaactctgatgaccgggtcttgttggatctgtct
gccttcctcaagaccattgcactgaatggtgtggaggacgtgcgaaccgtgctggagcac
tatgccctggaggatgacccgctggcggctttcaaacagcggcaaagccggctagagcag
gaggagcagcagcgcctggccgagctctccaagtccaacaagcagaacctcttccttggc
tccctcaccagccgcttgtggcctcgctccaaacagccctga

DBGET integrated database retrieval system