KEGG   Homo sapiens (human): 9261Help
Entry
9261              CDS       T01001                                 

Gene name
MAPKAPK2, MAPKAP-K2, MK-2, MK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04218  Cellular senescence
hsa04370  VEGF signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    9261 (MAPKAPK2)
   04370 VEGF signaling pathway
    9261 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    9261 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    9261 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    9261 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    9261 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    9261 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9261 (MAPKAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9261 (MAPKAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   9261 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 9261
NCBI-ProteinID: NP_116584
OMIM: 602006
HGNC: 6887
Ensembl: ENSG00000162889
Vega: OTTHUMG00000036342
Pharos: P49137(Tchem)
UniProt: P49137
Structure
PDB: 

Position
1q32.1
AA seq 400 aa AA seqDB search
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactcccagggccagagcccgccggtgccgttccccgccccggccccgccg
ccgcagccccccacccctgccctgccgcaccccccggcgcagccgccgccgccgcccccg
cagcagttcccgcagttccacgtcaagtccggcctgcagatcaagaagaacgccatcatc
gatgactacaaggtcaccagccaggtcctggggctgggcatcaacggcaaagttttgcag
atcttcaacaagaggacccaggagaaattcgccctcaaaatgcttcaggactgccccaag
gcccgcagggaggtggagctgcactggcgggcctcccagtgcccgcacatcgtacggatc
gtggatgtgtacgagaatctgtacgcagggaggaagtgcctgctgattgtcatggaatgt
ttggacggtggagaactctttagccgaatccaggatcgaggagaccaggcattcacagaa
agagaagcatccgaaatcatgaagagcatcggtgaggccatccagtatctgcattcaatc
aacattgcccatcgggatgtcaagcctgagaatctcttatacacctccaaaaggcccaac
gccatcctgaaactcactgactttggctttgccaaggaaaccaccagccacaactctttg
accactccttgttatacaccgtactatgtggctccagaagtgctgggtccagagaagtat
gacaagtcctgtgacatgtggtccctgggtgtcatcatgtacatcctgctgtgtgggtat
ccccccttctactccaaccacggccttgccatctctccgggcatgaagactcgcatccga
atgggccagtatgaatttcccaacccagaatggtcagaagtatcagaggaagtgaagatg
ctcattcggaatctgctgaaaacagagcccacccagagaatgaccatcaccgagtttatg
aaccacccttggatcatgcaatcaacaaaggtccctcaaaccccactgcacaccagccgg
gtcctgaaggaggacaaggagcggtgggaggatgtcaaggaggagatgaccagtgccttg
gccacaatgcgcgttgactacgagcagatcaagataaaaaagattgaagatgcatccaac
cctctgctgctgaagaggcggaagaaagctcgggccctggaggctgcggctctggcccac
tga

DBGET integrated database retrieval system