KEGG   Homo sapiens (human): 92610Help
Entry
92610             CDS       T01001                                 

Gene name
TIFA, T2BP, T6BP, TIFAA
Definition
(RefSeq) TRAF interacting protein with forkhead associated domain
  KO
K23826  TRAF-interacting protein with FHA domain-containing protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    92610 (TIFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-GeneID: 92610
NCBI-ProteinID: NP_443096
OMIM: 609028
HGNC: 19075
Ensembl: ENSG00000145365
Vega: OTTHUMG00000161066
Pharos: Q96CG3(Tbio)
UniProt: Q96CG3
Structure
PDB: 

Position
4q25
AA seq 184 aa AA seqDB search
MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTF
QDKQVSRVQFSLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFG
EYQFLMEKEDGESLEFFETQFILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMD
ENES
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaccagttttgaagatgctgacacagaagagacagtaacttgtctccagatgacggtt
taccatcctggccagttgcagtgtggaatatttcagtcaataagttttaacagagagaaa
ctcccttccagcgaagtggtgaaatttggccgaaattccaacatctgtcattatactttt
caggacaaacaggtttcccgagttcagttttctctgcagctgtttaaaaaattcaacagc
tcagttctctcctttgaaataaaaaatatgagtaaaaagaccaatctgatcgtggacagc
agagagctgggctacctaaataaaatggacctgccatacaggtgcatggtcagattcgga
gagtatcagtttctgatggagaaggaagatggcgagtcattggaattttttgagactcaa
tttattttatctccaagatcactcttgcaagaaaacaactggccaccacacaggcccata
ccggagtatggcacttattcgctctgctcctcccaaagcagttctccgacagaaatggat
gaaaatgagtcatga

DBGET integrated database retrieval system