KEGG   Homo sapiens (human): 9263
Entry
9263              CDS       T01001                                 

Gene name
STK17A, DRAK1
Definition
(RefSeq) serine/threonine kinase 17a
  KO
K08804  serine/threonine kinase 17 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9263 (STK17A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9263 (STK17A)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   9263 (STK17A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1
Other DBs
NCBI-GeneID: 9263
NCBI-ProteinID: NP_004751
OMIM: 604726
HGNC: 11395
Ensembl: ENSG00000164543
Vega: OTTHUMG00000022825
Pharos: Q9UEE5(Tchem)
UniProt: Q9UEE5
Position
7p13
AA seq 414 aa
MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYS
LCPGRELGRGKFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPW
VINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTR
DVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPI
SMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT
LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSE
TKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgatccctttggagaagccaggcagcggcggctcctccccaggcgccacctcaggctcg
ggccgggcaggccggggtctgagcgggccgtgccggccgccgccgccgccccaggcccgc
gggctgctgacagagatacgcgccgtggtgcgcaccgagcccttccaggacggctacagc
ctgtgcccgggccgggagctgggcagggggaaatttgcagtggtgagaaaatgtataaag
aaagattctgggaaagaatttgctgcaaagttcatgagaaaaagaagaaaaggccaagat
tgtcggatggaaataattcatgagattgctgtacttgaactagcacaagacaatccttgg
gtcattaatttacatgaagtttatgagactgcatcagaaatgatcttagttctggaatat
gctgctgggggtgaaatctttgaccagtgtgttgcagacagagaagaagcctttaaagaa
aaagatgttcaaagacttatgcgacagattttagaaggtgttcactttttacacactcgt
gatgtagttcatcttgatttgaagcctcagaatattctgttgacaagtgaatctccattg
ggtgacattaagattgttgattttggcctttcaagaatattgaagaacagtgaagagctc
cgagaaattatgggtacccctgaatatgtggctcctgaaattcttagttatgatcctata
agcatggcaacagatatgtggagcattggagtgttaacatatgtcatgcttacaggaata
tcacctttcttaggcaatgataaacaagaaacattcttaaacatctcacagatgaattta
agttattctgaggaagaatttgatgttttgtctgagtcggctgttgatttcatcaggaca
cttttagttaagaaacctgaagatcgagccactgctgaagaatgtctaaagcacccctgg
ttgacacagagcagtattcaagagccttctttcaggatggaaaaggcactagaagaagca
aatgccctccaagaaggtcattctgtgcctgaaattaattcggataccgacaaatcagaa
accaaggaatccattgtaaccgaagagttaattgtagttacttcatatactctaggacaa
tgcagacagtctgaaaaagagaaaatggagcaaaaggccatttccaaacgatttaaattt
gaggaacctttgctacaagaaattccaggagaatttatctactga

DBGET integrated database retrieval system