KEGG   Homo sapiens (human): 9265Help
Entry
9265              CDS       T01001                                 

Gene name
CYTH3, ARNO3, GRP1, PSCD3, cytohesin-3
Definition
(RefSeq) cytohesin 3
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9265 (CYTH3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9265 (CYTH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9265 (CYTH3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9265 (CYTH3)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9265 (CYTH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 SASRP1 GPS2_interact
Motif
Other DBs
NCBI-GeneID: 9265
NCBI-ProteinID: NP_004218
OMIM: 605081
HGNC: 9504
Ensembl: ENSG00000008256
Vega: OTTHUMG00000023440
Pharos: O43739(Tbio)
UniProt: O43739
Structure
PDB: 

Position
7p22.1
AA seq 399 aa AA seqDB search
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagacggcggcggcgagggtggtggcgtgcctgaagacctctcattagaagag
agagaagaacttctagacattcgtcgaagaaaaaaggaacttattgatgacattgagagg
ctgaaatatgaaattgcagaggtgatgacagagatcgacaatctaacttccgtagaggag
agcaaaacgactcagaggaacaaacagatagccatgggaagaaagaaattcaacatggat
cccaaaaagggaattcagtttctaatagaaaatgacctgctacagagttccccagaagac
gtcgcccagttcctttataaaggagaaggcctaaataagaccgtcattggggactacctg
ggtgaaagggatgaatttaatattaaagttcttcaagcctttgttgaactccatgagttt
gctgatctcaaccttgtacaagccttaaggcagttcttatggagcttcaggctgcccggg
gaggcgcagaagattgatcgcatgatggaggctttcgcttctcgctactgcctgtgcaac
cccggggtcttccagtccacagacacgtgctacgtgctgtcattcgccatcatcatgctc
aacaccagcctccacaaccacaacgtgcgtgacaagcccacggcagaacggttcatcgcc
atgaaccgcggcatcaacgagggcggggacctccctgaggagctgctgaggaatttgtat
gagagcattaagaacgagccatttaagatcccggaggacgacgggaacgacctgacccac
accttcttcaaccccgaccgcgagggctggctcctgaagctgggagggcgtgtgaagacc
tggaagcgccggtggttcatcctgaccgataactgcctctattactttgaatacacaaca
gataaggagcccaggggaatcatcccgttggaaaacctcagcatcagggaggtggaggac
ccccggaaacccaactgttttgagctctacaatcccagccacaaagggcaggtcatcaag
gcctgtaagactgaggccgacggccgcgtggtagaggggaaccatgtggtgtaccggatc
tcagccccgagcccggaggagaaggaggagtggatgaaatccatcaaagccagtatcagc
agagatcccttctatgacatgttggcaacgaggaaacgaaggattgccaataaaaaatag

DBGET integrated database retrieval system