KEGG   Homo sapiens (human): 9266Help
Entry
9266              CDS       T01001                                 

Gene name
CYTH2, ARNO, CTS18, CTS18.1, PSCD2, PSCD2L, SEC7L, Sec7p-L, Sec7p-like, cytohesin-2
Definition
(RefSeq) cytohesin 2
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9266 (CYTH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9266 (CYTH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9266 (CYTH2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9266 (CYTH2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9266 (CYTH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 PH_16 NUDE_C
Motif
Other DBs
NCBI-GeneID: 9266
NCBI-ProteinID: NP_059431
OMIM: 602488
HGNC: 9502
Ensembl: ENSG00000105443
Vega: OTTHUMG00000150245
Pharos: Q99418(Tbio)
UniProt: Q99418
Structure
PDB: 

Position
19q13.33
AA seq 400 aa AA seqDB search
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaggacggcgtctatgaacccccagacctgactccggaggagcggatggagctggag
aacatccggcggcggaagcaggagctgctggtggagattcagcgcctgcgggaggagctc
agtgaagccatgagcgaggtggaggggctggaggccaatgagggcagtaagaccttgcaa
cggaaccggaagatggcaatgggcaggaagaagttcaacatggaccccaagaaggggatc
cagttcttggtggagaatgaactgctgcagaacacacccgaggagatcgcccgcttcctg
tacaagggcgaggggctgaacaagacagccatcggggactacctgggggagagggaagaa
ctgaacctggcagtgctccatgcttttgtggatctgcatgagttcaccgacctcaatctg
gtgcaggccctcaggcagtttctatggagctttcgcctacccggagaggcccagaaaatt
gaccggatgatggaggccttcgcccagcgatactgcctgtgcaaccctggggttttccag
tccacagacacgtgctatgtgctgtccttcgccgtcatcatgctcaacaccagtctccac
aatcccaatgtccgggacaagccgggcctggagcgctttgtggccatgaaccggggcatc
aacgagggcggggacctgcctgaggagctgctcaggaacctgtacgacagcatccgaaat
gagcccttcaagattcctgaggatgacgggaatgacctgacccacaccttcttcaacccg
gaccgggagggctggctcctgaagctgggagggggccgggtgaagacgtggaagcggcgc
tggtttatcctcacagacaactgcctctactactttgagtacaccacggacaaggagccc
cgaggaatcatccccctggagaatctgagcatccgagaggtggacgacccccggaaaccg
aactgctttgaactttacatccccaacaacaaggggcagctcatcaaagcctgcaaaact
gaggcggacggccgagtggtggagggaaaccacatggtgtaccggatctcggcccccacg
caggaggagaaggacgagtggatcaagtccatccaggcggctgtgagtgtggaccccttc
tatgagatgctggcagcgagaaagaagcggatttcagtcaagaagaagcaggagcagccc
tga

DBGET integrated database retrieval system