KEGG   Homo sapiens (human): 9267Help
Entry
9267              CDS       T01001                                 

Gene name
CYTH1, B2-1, CYTOHESIN-1, D17S811E, PSCD1, SEC7
Definition
(RefSeq) cytohesin 1
  KO
K18441  cytohesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    9267 (CYTH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9267 (CYTH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9267 (CYTH1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9267 (CYTH1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9267 (CYTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 BBS2_C GPS2_interact FapA APG6_N Pilosulin SLX9 PH_16 CEP170_C Spc7
Motif
Other DBs
NCBI-GeneID: 9267
NCBI-ProteinID: NP_004753
OMIM: 182115
HGNC: 9501
Ensembl: ENSG00000108669
Vega: OTTHUMG00000150253
Pharos: Q15438(Tbio)
UniProt: Q15438
Structure
PDB: 

Position
17q25.3
AA seq 398 aa AA seqDB search
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacgacagctacgttcccagtgacctgacagcagaggagcgtcaagaactg
gagaacatccgacggagaaaacaggagctgctggctgacattcagaggctgaaggatgag
atagcagaagtagctaatgaaattgaaaacctgggatccacagaggaaaggaaaaacatg
cagaggaacaaacaggtagccatgggcaggaaaaaatttaatatggaccctaaaaagggg
atccagttcttaatagagaacgacctcctgaagaacacttgtgaagacattgcccagttc
ttatataaaggcgaagggctcaacaagacagccatcggcgactacctaggggagagagat
gagtttaatatccaggttcttcatgcatttgtggagctgcatgagttcactgatcttaat
ctcgtccaggcactacggcagttcctgtggagcttccggctacccggagaggcccagaag
atcgaccggatgatggaggcgtttgcccagcgatattgtcagtgcaataatggcgtgttc
cagtccacggatacttgttacgtcctctcctttgccatcatcatgttgaacaccagtctg
cacaaccccaatgtcaaagataagcccactgtggagaggttcattgccatgaaccgaggc
atcaatgatgggggagacctgccggaggagctcctccggaatctctatgagagcataaaa
aatgaaccctttaaaatcccagaagacgacgggaatgacctcactcacactttcttcaat
ccagaccgagaaggctggctattgaaactcggaggtggcagggtaaagacttggaagaga
cgctggttcattctgactgacaactgcctttactactttgagtataccacggataaggag
ccccgtggaatcatccctttagagaatctgagtatccgggaagtggaggactccaaaaaa
ccaaactgctttgagctttatatccccgacaataaagaccaagttatcaaggcctgcaag
accgaggctgacgggcgggtggtggaggggaaccacactgtttaccggatctcagctccg
acgcccgaggagaaggaggagtggattaagtgcattaaagcagccatcagcagggaccct
ttctacgaaatgctcgcagcacggaaaaagaaggtctcctccacgaagcgacactga

DBGET integrated database retrieval system