KEGG   Homo sapiens (human): 92675
Entry
92675             CDS       T01001                                 

Gene name
DTD1, C20orf88, DTD, DUE-B, DUEB, HARS2, pqn-68
Definition
(RefSeq) D-aminoacyl-tRNA deacylase 1
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    92675 (DTD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     92675 (DTD1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    92675 (DTD1)
 Prokaryotic type
    92675 (DTD1)
SSDB
Motif
Pfam: Tyr_Deacylase Kinocilin
Other DBs
NCBI-GeneID: 92675
NCBI-ProteinID: NP_543010
OMIM: 610996
HGNC: 16219
Ensembl: ENSG00000125821
Vega: OTTHUMG00000031980
Pharos: Q8TEA8(Tdark)
UniProt: Q8TEA8
Structure
PDB: 
2OKV

Position
20p11.23
AA seq 209 aa
MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESG
KHWSKSVMDKQYEILCVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPE
LIKDGKFGAYMQVHIQNDGPVTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSE
SSKERNTPRKEDRSASSGAEGDVSSEREP
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaaggccgtggtgcagcgcgtcacccgggccagcgtcacagttggaggagagcagatt
agtgccattggaaggggcatatgtgtgttgctgggtatttccctggaggatacgcagaag
gaactggaacacatggtccgaaagattctaaacctgcgtgtatttgaggatgagagtggg
aagcactggtcgaagagtgtgatggacaaacagtacgagattctgtgtgtcagccagttt
accctccagtgtgtcctgaagggaaacaagcctgatttccacctagcaatgcccacggag
caggcagagggcttctacaacagcttcctggagcagctgcgtaaaacatacaggccggag
cttatcaaagatggcaagtttggggcctacatgcaggtgcacattcagaatgatgggcct
gtgaccatagagctggaatcgccagctcccggcactgctacctctgacccaaagcagctg
tcaaagctcgaaaaacagcagcagaggaaagaaaagaccagagctaagggaccttctgaa
tcaagcaaggaaagaaacactccccgaaaagaagaccgcagtgccagcagcggggctgag
ggcgacgtgtcctctgaacgggagccgtag

DBGET integrated database retrieval system