KEGG   Homo sapiens (human): 9271
Entry
9271              CDS       T01001                                 

Gene name
PIWIL1, CT80.1, HIWI, MIWI, PIWI
Definition
(RefSeq) piwi like RNA-mediated gene silencing 1
  KO
K02156  aubergine
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9271 (PIWIL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    9271 (PIWIL1)
   piRNA pathway
    9271 (PIWIL1)
SSDB
Motif
Pfam: Piwi PAZ GAGE ArgoN ArgoL1
Other DBs
NCBI-GeneID: 9271
NCBI-ProteinID: NP_004755
OMIM: 605571
HGNC: 9007
Ensembl: ENSG00000125207
Vega: OTTHUMG00000168382
Pharos: Q96J94(Tbio)
UniProt: Q96J94 A0A024RBS5
Structure
PDB: 
3O7V 3O3I 3O6E 2L5C 2L5D

Position
12q24.33
AA seq 861 aa
MTGRARARARGRARGQETAQLVGSTASQQPGYIQPRPQPPPAEGELFGRGRQRGTAGGTA
KSQGLQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
LTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTE
VFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPID
IPSHRLVIWPGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVS
KELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQP
VLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQRE
VGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSK
ETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEA
YLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAI
ATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFS
RCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQF
LDCLKSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIV
SQAVRSGSVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAF
LVGQSIHREPNLSLSNRLYYL
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgactgggagagcccgagccagagccagaggaagggcccgcggtcaggagacagcgcag
ctggtgggctccactgccagtcagcaacctggttatattcagcctaggcctcagccgcca
ccagcagagggggaattatttggccgtggacggcagagaggaacagcaggaggaacagcc
aagtcacaaggactccagatatctgctggatttcaggagttatcgttagcagagagagga
ggtcgtcgtagagattttcatgatcttggtgtgaatacaaggcagaacctagaccatgtt
aaagaatcaaaaacaggttcttcaggcattatagtaaggttaagcactaaccatttccgg
ctgacatcccgtccccagtgggccttatatcagtatcacattgactataacccactgatg
gaagccagaagactccgttcagctcttctttttcaacacgaagatctaattggaaagtgt
catgcttttgatggaacgatattatttttacctaaaagactacagcaaaaggttactgaa
gtttttagtaagacccggaatggagaggatgtgaggataacgatcactttaacaaatgaa
cttccacctacatcaccaacttgtttgcagttctataatattattttcaggaggcttttg
aaaatcatgaatttgcaacaaattggacgaaattattataacccaaatgacccaattgat
attccaagtcacaggttggtgatttggcctggcttcactacttccatccttcagtatgaa
aacagcatcatgctctgcactgacgttagccataaagtccttcgaagtgagactgttttg
gatttcatgttcaacttttatcatcagacagaagaacataaatttcaagaacaagtttcc
aaagaactaataggtttagttgttcttaccaagtataacaataagacatacagagtggat
gatattgactgggaccagaatcccaagagcacctttaagaaagccgacggctctgaagtc
agcttcttagaatactacaggaagcaatacaaccaagagatcaccgacttgaagcagcct
gtcttggtcagccagcccaagagaaggcggggccctggggggacactgccagggcctgcc
atgctcattcctgagctctgctatcttacaggtctaactgataaaatgcgtaatgatttt
aacgtgatgaaagacttagccgttcatacaagactaactccagagcaaaggcagcgtgaa
gtgggacgactcattgattacattcataaaaacgataatgttcaaagggagcttcgagac
tggggtttgagctttgattccaacttactgtccttctcaggaagaattttgcaaacagaa
aagattcaccaaggtggaaaaacatttgattacaatccacaatttgcagattggtccaaa
gaaacaagaggtgcaccattaattagtgttaagccactagataactggctgttgatctat
acgcgaagaaattatgaagcagccaattcattgatacaaaatctatttaaagttacacca
gccatgggcatgcaaatgagaaaagcaataatgattgaagtggatgacagaactgaagcc
tacttaagagtcttacagcaaaaggtcacagcagacacccagatagttgtctgtctgttg
tcaagtaatcggaaggacaaatacgatgctattaaaaaatacctgtgtacagattgccct
accccaagtcagtgtgtggtggcccgaaccttaggcaaacagcaaactgtcatggccatt
gctacaaagattgccctacagatgaactgcaagatgggaggagagctctggagggtggac
atccccctgaagctcgtgatgatcgttggcatcgattgttaccatgacatgacagctggg
cggaggtcaatcgcaggatttgttgccagcatcaatgaagggatgacccgctggttctca
cgctgcatatttcaggatagaggacaggagctggtagatgggctcaaagtctgcctgcaa
gcggctctgagggcttggaatagctgcaatgagtacatgcccagccggatcatcgtgtac
cgcgatggcgtaggagacggccagctgaaaacactggtgaactacgaagtgccacagttt
ttggattgtctaaaatccattggtagaggttacaaccctagactaacggtaattgtggtg
aagaaaagagtgaacaccagattttttgctcagtctggaggaagacttcagaatccactt
cctggaacagttattgatgtagaggttaccagaccagaatggtatgacttttttatcgtg
agccaggctgtgagaagtggtagtgtttctcccacacattacaatgtcatctatgacaac
agcggcctgaagccagaccacatacagcgcttgacctacaagctgtgccacatctattac
aactggccaggtgtcattcgtgttcctgctccttgccagtacgcccacaagctggctttt
cttgttggccagagtattcacagagagccaaatctgtcactgtcaaaccgcctttactac
ctctaa

DBGET integrated database retrieval system