KEGG   Homo sapiens (human): 92714
Entry
92714             CDS       T01001                                 
Symbol
ARRDC1
Name
(RefSeq) arrestin domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Arrestin_C Arrestin_N Vps26 Zincin_2
Other DBs
NCBI-GeneID: 92714
NCBI-ProteinID: NP_689498
OMIM: 619768
HGNC: 28633
Ensembl: ENSG00000197070
Pharos: Q8N5I2(Tdark)
UniProt: Q8N5I2
Position
9:137605686..137615360
AA seq 433 aa
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
SCGGVEPSLTPES
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggggcgagtgcagctcttcgagatcagcctgagccacggccgcgtcgtctacagcccc
ggggagccgttggctgggaccgtgcgcgtgcgcctgggggcaccgctgccgttccgagcc
atccgggtgacctgcataggttcctgcggggtctccaacaaggctaatgacacagcgtgg
gtagtggaggagggttacttcaacagttccctgtcgctggcagacaaggggagcctgccc
gctggagagcacagcttccccttccagttcctgcttcctgccactgcacccacgtccttt
gagggtcctttcgggaagatcgtgcaccaggtgagggccgccatccacacgccacggttt
tccaaggatcacaagtgcagcctcgtgttctatatcttgagccccttgaacctgaacagc
atcccagacattgagcaacccaacgtggcctctgccaccaagaagttctcctacaagctg
gtgaagacgggcagcgtggtcctcacagccagcactgatctccgcggctatgtggtgggg
caggcactgcagctgcatgccgacgttgagaaccagtcaggcaaggacaccagccctgtg
gtggccagtctgctgcagaaagtgtcctataaggccaagcgctggatccacgacgtacgg
accattgcggaggtggagggtgcgggcgtcaaggcctggcggcgggcgcagtggcacgag
cagatcctggtgcctgccttgccccagtcggccctgccgggctgcagcctcatccacatc
gactactacttacaggtctctctgaaggcgccggaagctactgtgaccctcccggtcttc
attggcaatattgctgtgaaccatgccccagtgagcccccggccaggcctggggctgcct
cctggggccccacccctggtggtgccttccgcaccaccccaggaggaggctgaggctgag
gctgcggctggcggcccccacttcttggaccccgtcttcctctccaccaagagccattcg
cagcggcagcccctgctggccaccttgagttctgtgcctggtgcgccggagccctgccct
caggatggcagccctgcctcacacccgctgcaccctcccttgtgcatttcaacaggtgcc
actgtcccctactttgcagagggctccggggggccagtgcccactaccagcaccttgatt
cttcctccagagtacagttcttggggctacccctatgaggccccaccgtcttatgagcag
agctgcggcggcgtggaacccagcctgacccctgagagctga

DBGET integrated database retrieval system