KEGG   Homo sapiens (human): 92737Help
Entry
92737             CDS       T01001                                 

Gene name
DNER, UNQ26, bet
Definition
(RefSeq) delta/notch like EGF repeat containing
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_2 EGF_3 EGF_CA IMUP
Motif
Other DBs
NCBI-GeneID: 92737
NCBI-ProteinID: NP_620711
OMIM: 607299
HGNC: 24456
Ensembl: ENSG00000187957
Vega: OTTHUMG00000153637
Pharos: Q8NFT8(Tbio)
UniProt: Q8NFT8
Position
2q36.3
AA seq 737 aa AA seqDB search
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccgccgcgcccaggcgcccggtgcgcagctgctgcccgcgctggccctgctg
ctgctgctgctcggagcggggccccgaggcagctccctggccaacccggtgcccgccgcg
cccctgtctgcgcccgggccgtgcgccgcgcagccctgccggaatgggggtgtgtgcacc
tcgcgccctgagccggacccgcagcacccggcccccgccggcgagcctggctacagctgc
acctgccccgccgggatctccggcgccaactgccagcttgttgcagatccttgtgccagc
aacccttgtcaccatggcaactgcagcagcagcagcagcagcagcagcgatggctacctc
tgcatttgcaatgaaggctatgaaggtcccaactgtgaacaggcacttcccagtctccca
gccactggctggaccgaatccatggcaccccgacagcttcagcctgttcctgctactcag
gagcctgacaaaatcctgcctcgctctcaggcaacggtgacactgcctacctggcagccg
aaaacagggcagaaagttgtagaaatgaaatgggatcaagtggaggtgatcccagatatt
gcctgtgggaatgccagttctaacagctctgcgggtggccgcctggtatcctttgaagtg
ccacagaacacctcagtcaagattcggcaagatgccactgcctcactgattttgctctgg
aaggtcacggccacaggattccaacagtgctccctcatagatggacgaagtgtgaccccc
cttcaggcttcagggggactggtcctcctggaggagatgctcgccttggggaataatcac
tttattggttttgtgaatgattctgtgactaagtctattgtggctttgcgcttaactctg
gtggtgaaggtcagcacctgtgtgccgggggagagtcacgcaaatgacttggagtgttca
ggaaaaggaaaatgcaccacgaagccgtcagaggcaactttttcctgtacctgtgaggag
cagtacgtgggtactttctgtgaagaatacgatgcttgccagaggaaaccttgccaaaac
aacgcgagctgtattgatgcaaatgaaaagcaagatgggagcaatttcacctgtgtttgc
cttcctggttatactggagagctttgccagtccaagattgattactgcatcctagaccca
tgcagaaatggagcaacatgcatttccagtctcagtggattcacctgccagtgtccagaa
ggatacttcggatctgcttgtgaagaaaaggtggacccctgcgcctcgtctccgtgccag
aacaacggcacctgctatgtggacggggtacactttacctgcaactgcagcccgggcttc
acagggccgacctgtgcccagcttattgacttctgtgccctcagcccctgtgctcatggc
acgtgccgcagcgtgggcaccagctacaaatgcctctgtgatccaggttaccatggcctc
tactgtgaggaggaatataatgagtgcctctccgctccatgcctgaatgcagccacctgc
agggacctcgttaatggctatgagtgtgtgtgcctggcagaatacaaaggaacacactgt
gaattgtacaaggatccctgcgctaacgtcagctgtctgaacggagccacctgtgacagc
gacggcctgaatggcacgtgcatctgtgcacccgggtttacaggtgaagagtgcgacatt
gacataaatgaatgtgacagtaacccctgccaccatggtgggagctgcctggaccagccc
aatggttataactgccactgcccgcatggttgggtgggagcaaactgtgagatccacctc
caatggaagtccgggcacatggcggagagcctcaccaacatgccacggcactccctctac
atcatcattggagccctctgcgtggccttcatccttatgctgatcatcctgatcgtgggg
atttgccgcatcagccgcattgaataccagggttcttccaggccagcctatgaggagttc
tacaactgccgcagcatcgacagcgagttcagcaatgccattgcatccatccggcatgcc
aggtttggaaagaaatcccggcctgcaatgtatgatgtgagccccatcgcctatgaagat
tacagtcctgatgacaaacccttggtcacactgattaaaactaaagatttgtaa

DBGET integrated database retrieval system