KEGG   Homo sapiens (human): 92745Help
Entry
92745             CDS       T01001                                 

Gene name
SLC38A5, JM24, SN2, SNAT5, pp7194
Definition
(RefSeq) solute carrier family 38 member 5
  KO
K14992  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    92745 (SLC38A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    92745 (SLC38A5)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   92745 (SLC38A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aa_trans
Motif
Other DBs
NCBI-GeneID: 92745
NCBI-ProteinID: NP_277053
OMIM: 300649
HGNC: 18070
Ensembl: ENSG00000017483
Vega: OTTHUMG00000024117
Pharos: Q8WUX1(Tbio)
UniProt: Q8WUX1 A0A024QYY0
Position
Xp11.23
AA seq 472 aa AA seqDB search
MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKTSFGMSVFNLSNA
IMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCAGIAGIRAYEQLGQRAFG
PAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGTFLYMDPEGDWFLKGNLLIIIVSVL
IILPLALMKHLGYLGYTSGLSLTCMLFFLVSVIYKKFQLGCAIGHNETAMESEALVGLPS
QGLNSSCEAQMFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGA
MFCMYGLTATFGYLTFYSSVKAEMLHMYSQKDPLILCVRLAVLLAVTLTVPVVLFPIRRA
LQQLLFPGKAFSWPRHVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIFILPSIF
YLRIVPSEVEPFLSWPKIQALCFGVLGVLFMAVSLGFMFANWATGQSRMSGH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcaggatccaaagatgaatggagccctcccttcggatgctgtgggctacagg
caagaacgtgagggcttcctgcccagtcgtggtcctgctcctgggagcaagccggtccag
ttcatggatttcgaggggaagacatcgtttggaatgtcagtgttcaacctcagcaacgcc
atcatgggcagcggcatcctggggctggcctatgccatggcccacacgggggtcatcttc
ttcctggccctgctgctgtgcattgcgcttctgtcgtcctactccatccacctcctgctg
acctgtgctggtattgcaggcatccgagcctatgagcagctgggacagagggcattcggg
cctgcggggaaggtagtggtggccacagtcatctgtctgcacaatgttggggccatgtcc
agttacctgttcatcatcaaatctgagctccccctggttatcggcaccttcctgtacatg
gaccccgagggggactggttcttgaagggaaacctcctcatcatcatcgtcagtgtgtta
atcatcctgcccctcgccctcatgaaacacttgggctacctggggtacaccagtggtctc
tctctgacctgcatgctgtttttccttgtttcggtcatctacaagaagttccaacttggc
tgtgctataggccacaatgaaacagcaatggagagtgaagctctcgtgggactccccagc
caaggactcaacagcagctgtgaggcccagatgttcacagttgactcacagatgtcctac
acagtgcccattatggcttttgcttttgtctgccaccctgaggtgctgcccatctatacg
gagctctgccggccctccaagcgcaggatgcaggccgtggccaacgtgtccattggggcc
atgttctgcatgtatgggctcacagcaacctttggatacctcaccttctacagcagtgtg
aaggcggagatgctgcacatgtacagccagaaggacccgctcatcctctgtgtgcgcctg
gccgtgctgctcgcggtgaccctcactgtgccagtcgtgctgttccctatccgccgggcc
ctgcagcagctgcttttcccaggcaaggccttcagctggccacgacatgtggccatagct
ctgatcctgcttgttttggtcaatgtccttgtcatctgtgtgccaaccatccgggatatc
tttggagttatcgggtccacctcagcccccagcctcatcttcatcctccccagcatcttc
tacctccgcattgtaccctctgaggtggagcctttcttatcctggcccaagatccaggcc
ctgtgctttggagtcctgggagtcctcttcatggccgtcagtctaggctttatgtttgcc
aactgggccacaggccagagccgcatgtctggacactga

DBGET integrated database retrieval system