KEGG   Homo sapiens (human): 9276Help
Entry
9276              CDS       T01001                                 

Gene name
COPB2, MCPH19, beta'-COP
Definition
(RefSeq) coatomer protein complex subunit beta 2
  KO
K17302  coatomer subunit beta'
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9276 (COPB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9276 (COPB2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    9276 (COPB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   9276 (COPB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_WDAD WD40 MetallophosC
Motif
Other DBs
NCBI-GeneID: 9276
NCBI-ProteinID: NP_004757
OMIM: 606990
HGNC: 2232
Ensembl: ENSG00000184432
Vega: OTTHUMG00000159959
Pharos: P35606(Tbio)
UniProt: P35606
Position
3q23
AA seq 906 aa AA seqDB search
MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPV
RAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDD
MLIKLWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFT
LEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQNVSCASFHPE
LPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLRGSNNVALGYDEGSIIVKLG
REEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQH
NPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAIRESNSIVKIFKNFKE
KKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIA
TEESFFILKYLSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSV
NRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLYLGDKELNIISYSLLVSVLEYQTAVMR
RDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQALTVSTDPEHRFELALQLGELKIAYQL
AVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLLLLATASGNANMVNKLAEGAE
RDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKV
NQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGK
DFQPSRSTAQQELDGKPASPTPVIVASHTANKEEKSLLELEVDLDNLELEDIDTTDINLD
EDILDD
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcgacttgatatcaaaagaaagctaactgctagatctgatcgagttaagagt
gtggatctgcatcctacagagccatggatgttggcaagtctttacaatggcagtgtgtgt
gtttggaatcatgaaacacagacactggtgaagacatttgaagtatgtgatcttcctgtt
cgagctgcaaagtttgttgcaaggaagaattgggttgtgacaggagcggatgacatgcag
attagagtgttcaattacaatactctggagagagttcatatgtttgaagcacactcagac
tacattcgctgtattgctgttcatccaacccagcctttcattctaactagcagtgatgac
atgcttattaagctctgggactgggataaaaaatggtcttgctcacaagtgtttgaagga
cacacccattatgttatgcagattgtgatcaaccccaaagataacaatcagtttgccagt
gcctctttggacaggactatcaaggtgtggcagttgggctcttcgtcaccaaacttcact
ttggaaggacatgagaaaggcgtgaattgcattgattactacagtggtggggacaagcca
tacctcatttcaggtgcagatgaccgtcttgttaaaatatgggattatcagaataaaaca
tgtgtgcagacactggaaggacatgcccaaaatgtgtcttgtgccagctttcatcctgag
ttgccaatcattatcacaggttcagaagatggaacagtacgtatttggcattcaagcacc
taccggcttgagagcacactgaattatggaatggagagggtatggtgcgtggccagtcta
agagggtcaaacaatgtcgctttgggctatgatgaagggagcatcattgttaagcttggt
cgggaggaacctgccatgtccatggatgccaatggaaagataatttgggccaagcattca
gaagtccagcaggccaacctaaaagcaatgggagatgctgaaattaaagatggtgaaaga
ttgccactggcagtaaaggatatgggcagttgtgaaatataccctcagactattcagcac
aatcctaatgggcggtttgtggtggtgtgtggtgatggggagtatatcatctacacagca
atggcattgagaaacaagagctttggatctgctcaggagtttgcatgggcccacgattct
tcagagtatgcaataagagagagcaacagcattgtaaagatatttaagaactttaaggaa
aaaaaatcatttaaaccagattttggagcagaaagtatctacggcggcttcttattggga
gtcagatctgtaaatggcttagccttctatgactgggacaatacagaactcatacgaaga
attgaaattcagcccaaacatattttctggtctgactctggagagctagtctgtattgct
actgaggaatcattttttatccttaagtatctgtcagaaaaagtcttggctgcacaggaa
acacatgagggagttactgaagatggcattgaagatgcctttgaggttcttggtgagatt
caggaaattgtgaaaacagggctttgggtaggcgattgcttcatttacacaagttctgtg
aacagattaaattattatgttggaggagaaatagtcaccattgcccacttggacaggacg
atgtatctcctaggctacattcctaaagacaacaggctttatctgggggataaagaattg
aacatcattagctattccctgctggtttcagtcctggaataccagacagctgtcatgcgg
agggactttagcatggctgataaggtccttcctaccattccaaaagaacagaggaccaga
gttgcacactttttggaaaagcagggcttcaagcagcaagctcttacagtatccacagat
cctgagcatcgttttgagcttgctcttcagcttggagagttaaaaattgcataccagtta
gcagtggaagcagagtcagaacagaagtggaaacaacttgctgaacttgccattagtaaa
tgtcagtttggcctagcccaggagtgcctgcatcatgcacaggattatgggggcctgctg
cttttggccactgcctctggaaatgctaatatggtgaacaagctagcagagggtgcggag
agagatggcaaaaataatgtggcattcatgagctactttttacagggcaaggttgatgcc
tgcctagagctcttaattagaactggacggctgccagaagctgccttcttggcccgaact
tacttacccagtcaggtttcaagggtagtgaaactctggagagagaatctctcaaaagtc
aatcagaaagcagcagaatcccttgctgacccaacagagtatgaaaacctgttccctgga
ttaaaagaagcctttgttgttgaagaatgggtgaaggaaacacatgctgatctgtggcca
gccaaacaatacccacttgtcacgccaaatgaagagagaaatgtcatggaagagggaaaa
gactttcagccctcaagatctacagctcaacaggaacttgatgggaaacctgcttctcct
actccggttattgtggcctcccacacagccaacaaagaagaaaagagtttactcgaacta
gaagtagatttggataatttggaattagaagatattgacacaacagatatcaatctggat
gaagatattttggatgattga

DBGET integrated database retrieval system