KEGG   Homo sapiens (human): 92815
Entry
92815             CDS       T01001                                 

Gene name
H2AW, HIST3H2A
Definition
(RefSeq) H2A.W histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    92815 (H2AW)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    92815 (H2AW)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    92815 (H2AW)
  09165 Substance dependence
   05034 Alcoholism
    92815 (H2AW)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    92815 (H2AW)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92815 (H2AW)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    92815 (H2AW)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92815 (H2AW)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 92815
NCBI-ProteinID: NP_254280
OMIM: 615015
HGNC: 20507
Ensembl: ENSG00000181218
Vega: OTTHUMG00000040046
Pharos: Q7L7L0(Tbio)
UniProt: Q7L7L0
Position
1q42.13
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggtcgtggtaagcagggtggcaaggcgcgcgccaaggctaagtcgcgctcgtcg
cgcgcggggctgcagttccccgtgggccgcgtgcaccggttgctccgcaagggcaactat
tcggagcgcgtgggcgccggcgccccggtctatctggccgcggtgctcgagtacttgact
gccgagatcctggagcttgccggcaacgcggcgcgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggtggcgtcctgcccaacatccaggccgtactgctgcccaagaag
acggagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system