KEGG   Homo sapiens (human): 9282
Entry
9282              CDS       T01001                                 

Gene name
MED14, CRSP150, CRSP2, CSRP, CXorf4, DRIP150, EXLM1, RGR1, TRAP170
Definition
(RefSeq) mediator complex subunit 14
  KO
K15156  mediator of RNA polymerase II transcription subunit 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
Network
nt06310  CRH-ACTH-cortisol signaling
  Element
N00924  Glucocorticoid receptor signaling pathway
N00925  Mutation-inactivated NR3C1 to glucocorticoid receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    9282 (MED14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    9282 (MED14)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Tail
     9282 (MED14)
SSDB
Motif
Pfam: Med14
Other DBs
NCBI-GeneID: 9282
NCBI-ProteinID: NP_004220
OMIM: 300182
HGNC: 2370
Ensembl: ENSG00000180182
Vega: OTTHUMG00000024107
Pharos: O60244(Tbio)
UniProt: O60244
Position
Xp11.4
AA seq 1454 aa
MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLH
RAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISS
FLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPP
DPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDD
PDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQDMYNCLHSFC
LSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIK
IDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAIL
RGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEK
SVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFI
KLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVF
RTKTGKQTRTNAKRKLSDDPCPVESKKTKRAGEMCAFNKVLAHFVAMCDTNMPFVGLRLE
LSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKALDRSLLDCTFRLQGRNNRTW
VAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECV
LEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGP
NSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTA
YQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLK
TFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYP
LTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGP
GASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPAARMPGMSPANPSLHSPVPD
ASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAG
SYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQT
LQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIM
KLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEP
VSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVR
DLMANLTLPPGGRP
NT seq 4365 nt   +upstreamnt  +downstreamnt
atggccccagtgcagctggagaaccaccagctggtcccgcccggaggcggcggcgggggc
agcggcggacccccgtcagccccagcccctcctcccccgggagccgccgtggcggcggcc
gctgcagctgcggctagcccgggctaccggctgagcaccctcattgaatttctgctgcac
cgggcctactcggagcttatggtgttgacggacctactgccaaggaaatctgatgtggaa
aggaaaatagaaatagtgcagtttgctagccggacacgccaactcttcgttcgattatta
gctttagtgaaatgggctaataatgctggcaaagtggaaaaatgtgcgatgatttcaagc
tttttagatcagcaagccatcctgtttgtggacactgctgatcgcctggcctcgttagct
agagatgctctggtccatgcacgcctgcctagttttgccatcccatatgccattgatgta
ctaactactggatcttacccacggctgccaacctgcattagggacaaaattattcctcca
gacccaattaccaaaattgaaaaacaagccacactccatcagctgaatcagattcttaga
catcggcttgtaaccacagatcttcctcctcagttagcaaatcttacagttgcaaatggc
cgggtgaagtttcgtgttgaaggagaatttgaagccaccttgactgtgatgggagatgac
cctgatgttccatggcgtcttctcaagctagaaattctagttgaggataaggaaacagga
gatgggcgagctttggttcatagcatgcaaatcagcttcatccatcaactggtgcagtct
aggctctttgctgatgagaaacctcttcaggatatgtacaactgcctacattctttctgt
ttatcacttcagttagaagtgttacattcccaaactctaatgttaatccgagaacggtgg
ggagaccttgtgcaggtggaaaggtatcatgctggaaagtgcctctccctttcagtttgg
aatcaacaggttcttgggagaaaaactggaacagcatctgttcacaaagttacaattaaa
attgatgagaatgatgtctccaagcctttacagatttttcacgatcctcctttgccagct
tctgattccaaattagtagaaagagccatgaagatcgaccacttatcaatagaaaaactc
ctgattgacagtgtccatgcaagagctcatcagaagctccaagaactgaaggccattctt
agaggcttcaatgccaatgaaaactcttccatagagactgcactcccagctcttgttgtt
cccatcttggagccctgtggtaattcagagtgtctgcacatttttgtagatttacattct
ggaatgtttcaattgatgctttatggacttgaccaggccactctggatgacatggagaag
tctgtgaatgatgatatgaaacgaatcataccctggattcagcaacttaagttttggctt
ggacaacagcgttgcaagcagtctataaaacatctgcctacgataagcagtgaaacattg
cagctttccaattactcaactcatcctattggaaacctttctaagaataaactgttcatt
aaacttacccgccttccacaatactacattgttgtggagatgttggaggttcccaataaa
cccacacaactgtcgtacaagtactactttatgtctgtgaatgctgcagatcgtgaagac
agccctgcaatggcattgctgctgcagcagttcaaggaaaacattcaggacttggttttt
cgtacaaaaaccgggaaacagaccagaaccaatgccaagcgcaagttgtctgatgatcca
tgtccagtagaatccaagaaaacaaaacgagcaggagaaatgtgtgccttcaataaagtt
ttagcccacttcgtcgctatgtgtgatacaaatatgccatttgtaggacttcggttggag
ttgtccaatctggagattccacatcaaggagtgcaagtggaaggtgatggcttcagccat
gcaattcgcttattaaaaattcctccctgtaagggtataactgaggaaacccaaaaggct
ctggaccgctctcttcttgattgcactttccgattacaaggtagaaataaccgcacttgg
gtagcagagttagtgtttgcaaattgtccacttaatggcacttctactagggagcaagga
ccatcccggcacgtttacctgacatatgaaaatctgttgtctgagcctgttggtggtaga
aaggtggttgaaatgtttcttaatgactggaatagcattgcacgattatatgagtgtgtg
ttggaatttgcacgttctctaccagacatacctgctcatctaaatattttctcagaagtt
cgtgtttataattaccgaaaacttatcttgtgttatggaaccaccaagggaagctcaatt
agtatccaatggaattcgatccatcaaaaattccacatttctttgggaactgttggccca
aactcaggttgcagtaactgtcacaataccattctccatcagcttcaagaaatgttcaac
aaaacaccaaatgtggttcagttattacaggtactgtttgatactcaggctccattaaat
gccatcaacaaactccccactgtgccgatgttgggcttgacccagagaaccaatactgcc
taccagtgcttctccattctgccacagtcgtccacccacatcagactggccttcaggaac
atgtattgcattgatatatactgccggagtcgaggtgttgtggcaatacgggatggtgcc
tatagtctttttgataacagcaaactagttgaaggtttctatcctgcaccaggactaaag
acgttcctgaatatgtttgttgacagcaatcaggatgctcgaagaaggtctgtaaatgag
gacgataatcccccttctcctataggaggagatatgatggattctttaatatcgcagctc
cagccaccaccccagcaacagccatttccaaagcagccaggaacatcaggtgcttatcct
cttacttcaccccctacatcttatcatagcacagtcaatcagtctccctcaatgatgcac
acacagtctccaggaaatctgcatgctgccagctcccccagtggggctttgagagcccca
tcaccagcgtcatttgttccaactcctcccccatcctcgcatggaatctcaataggacca
ggggccagttttgctagtccacatggaactcttgaccctagttccccatacactatggtg
tcaccaagtggacgagcagggaactggccaggatctcctcaagtgtctggcccctcacca
gcagcacgcatgcctggaatgtcaccagccaacccctcactacattctccggttccagat
gcttctcattcccctcgagctggaacaagttctcaaacaatgccaacaaacatgcctcca
cctcgtaaactacctcagcgctcttgggcggcatccatacctaccatcctcactcacagt
gccttgaacattttactgctgccctctccaactccaggccttgtgcccggcctggcaggt
agttacctttgttctccacttgagagattccttggatcagtcatcatgagacgacatctt
caaagaattattcaacaagaaacgctgcagctgataaattctaatgaacccggagtgatc
atgtttaagactgatgcactgaaatgcagagtagctcttagtcccaaaaccaaccaaacg
cttcagctaaaagtgacacctgaaaatgcaggacagtggaaacctgatgaacttcaagtt
ttggagaaattctttgaaacaagagttgcaggaccaccatttaaagctaatacgttaata
gccttcaccaagctattaggagctcctacacacatcctcagggattgtgtgcacattatg
aagctggagctgttccctgaccaagcaacacagctaaaatggaatgttcagttttgcctg
acgatccctcccagcgcgccgccgattgcacctcctgggacgcctgctgtggtgctgaaa
tccaaaatgctattttttcttcaactaactcagaaaacatcggtccctccccaagaacct
gttagtattatagttccaatcatttatgacatggcttcaggtacaacccagcaggcagac
attcccagacagcagaactcttctgttgctgctcccatgatggtcagcaacattctgaag
aggtttgcagagatgaatccaccacgacaaggtgaatgcacaatatttgcagctgttcgt
gatttaatggctaatcttacactgccccctggtgggcgtccatag

DBGET integrated database retrieval system