KEGG   Homo sapiens (human): 9283Help
Entry
9283              CDS       T01001                                 

Gene name
GPR37L1, ET(B)R-LP-2, ETBR-LP-2, ETBRLP2
Definition
(RefSeq) G protein-coupled receptor 37 like 1
  KO
K04244  prosaposin receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9283 (GPR37L1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prosaposin
    9283 (GPR37L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 9283
NCBI-ProteinID: NP_004758
OMIM: 617630
HGNC: 14923
Ensembl: ENSG00000170075
Vega: OTTHUMG00000035924
Pharos: O60883(Tbio)
UniProt: O60883
Position
1q32.1
AA seq 481 aa AA seqDB search
MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYV
PEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPL
YPVTESSYSAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVL
FFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVR
PIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYS
LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNST
VVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCIC
RPLGQAFLDCCCCCCCEECGGASEASAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTP
C
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggctgtggcccctggctgtctctcttgctgtgattttggctgtggggctaagc
agggtctctgggggtgcccccctgcacctgggcaggcacagagccgagacccaggagcag
cagagccgatccaagaggggcaccgaggatgaggaggccaagggcgtgcagcagtatgtg
cctgaggagtgggcggagtacccccggcccattcaccctgctggcctgcagccaaccaag
cccttggtggccaccagccctaaccccggcaaggatgggggcaccccagacagtgggcag
gaactgaggggcaatctgacaggagcaccagggcagaggctacagatccagaaccccctg
tatccggtgaccgagagctcctacagtgcctatgccatcatgcttctggcgctggtggtg
tttgcggtgggcattgtgggcaacctgtcggtcatgtgcatcgtgtggcacagctactac
ctgaagagtgcctggaactccatccttgccagcctggccctctgggattttctggtcctc
tttttctgcctccctattgtcatcttcaacgagatcaccaagcagaggctactgggtgac
gtttcttgtcgtgccgtgcccttcatggaggtctcctctctgggagtcacgactttcagc
ctctgtgccctgggcattgaccgcttccacgtggccaccagcaccctgcccaaggtgagg
cccatcgagcggtgccaatccatcctggccaagttggctgtcatctgggtgggctccatg
acgctggctgtgcctgagctcctgctgtggcagctggcacaggagcctgcccccaccatg
ggcaccctggactcatgcatcatgaaaccctcagccagcctgcccgagtccctgtattca
ctggtgatgacctaccagaacgcccgcatgtggtggtactttggctgctacttctgcctg
cccatcctcttcacagtcacctgccagctggtgacatggcgggtgcgaggccctccaggg
aggaagtcagagtgcagggccagcaagcacgagcagtgtgagagccagctcaacagcacc
gtggtgggcctgaccgtggtctacgccttctgcaccctcccagagaacgtctgcaacatc
gtggtggcctacctctccaccgagctgacccgccagaccctggacctcctgggcctcatc
aaccagttctccaccttcttcaagggcgccatcaccccagtgctgctcctttgcatctgc
aggccgctgggccaggccttcctggactgctgctgctgctgctgctgtgaggagtgcggc
ggggcttcggaggcctctgctgccaatgggtcggacaacaagctcaagaccgaggtgtcc
tcttccatctacttccacaagcccagggagtcacccccactcctgcccctgggcacacct
tgctga

DBGET integrated database retrieval system