KEGG   Homo sapiens (human): 92840Help
Entry
92840             CDS       T01001                                 

Gene name
REEP6, C19orf32, DP1L1, REEP6.1, REEP6.2, RP77, TB2L1, Yip2f
Definition
(RefSeq) receptor accessory protein 6
  KO
K17279  receptor expression-enhancing protein 5/6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92840 (REEP6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   92840 (REEP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TB2_DP1_HVA22
Motif
Other DBs
NCBI-GeneID: 92840
NCBI-ProteinID: NP_001316485
OMIM: 609346
HGNC: 30078
Ensembl: ENSG00000115255
Vega: OTTHUMG00000180072
Pharos: Q96HR9(Tdark)
UniProt: Q96HR9
Position
19p13.3
AA seq 211 aa AA seqDB search
MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNL
IGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFL
LFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVLQVLARS
RAGITPVAVAGPSTPLEADLKPSQTPQPKDK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctgaggcagcgcgtggagcacttcctggagcaaaggaacctggtcaccgaa
gtgctgggggcgctggaggccaagaccggggtggagaagcggtatctggctgcaggagcc
gtcactctgctaagcctgtatctgctgttcggctacggagcgtctctgctgtgcaatctc
atcggatttgtgtaccccgcatatgcctcaatcaaagctatcgagagcccaagcaaggac
gacgacactgtgtggctcacctactgggtggtgtacgccctgtttgggctggccgagttc
ttcagcgatctactcctgtcctggttccctttctactacgtgggcaagtgcgccttcctg
ttgttctgcatggctcccaggccctggaacggggctctcatgctgtatcagcgcgtcgtg
cgtccgctgttcctaaggcaccacggggccgtagacagaatcatgaacgacctcagcggg
cgagccctggacgcggcggccggaataaccaggaacgtcttgcaggtcctggcccgtagc
cgggcaggcatcaccccggtggctgtggccgggccctccactcccctggaagctgacctc
aagccaagccagaccccgcagccgaaggacaagtga

DBGET integrated database retrieval system