KEGG   Homo sapiens (human): 9293
Entry
9293              CDS       T01001                                 

Gene name
GPR52
Definition
(RefSeq) G protein-coupled receptor 52
  KO
K08407  G protein-coupled receptor 52
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9293 (GPR52)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    9293 (GPR52)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 9293
NCBI-ProteinID: NP_005675
OMIM: 604106
HGNC: 4508
Ensembl: ENSG00000203737
Vega: OTTHUMG00000034901
Pharos: Q9Y2T5(Tchem)
UniProt: Q9Y2T5 F2YGU0
Position
1q25.1
AA seq 361 aa
MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLT
VIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYI
ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGW
GKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAAFVVCFTYFHIFKICRQHTKEINDR
RARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF
LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEPKPRKRANSCS
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaatgaatccaggtggactgaatggaggatcctgaacatgagcagtggcattgtgaat
gtgtccgagcgtcactcctgcccacttggatttggccactacagtgtggtggatgtctgc
atcttcgagacagtggttattgtgttgctgacatttctgatcattgctgggaatctaaca
gttatctttgtctttcattgtgctccactgttacatcattatactaccagctatttcatt
cagacgatggcatatgctgatcttttcgttggagttagctgcttggttcctactctgtca
cttctccactactccacaggtgtccacgagtcattgacttgccaggtttttggatatatc
atctcagttctaaaaagtgtttctatggcatgtcttgcttgcatcagtgtggatcgttat
cttgcaataaccaagcctctttcctacaatcaactggtcaccccttgtcgcttgagaatt
tgcattattttgatctggatctactcctgcctaattttcttgccttccttttttggctgg
gggaaacctggttaccatggtgacatttttgaatggtgtgccacgtcttggctcaccagt
gcctattttactggctttattgtttgtttactttatgctcctgctgcctttgttgtctgc
ttcacttacttccacattttcaaaatttgccgtcagcacaccaaagagataaatgaccga
agagcccgattccctagtcatgaggtagattcttccagagagactggacacagccctgac
cgtcgctacgccatggttttgtttaggataaccagtgtattttatatgctgtggctcccc
tatataatttactttcttctagaaagctcccgggtcttggacaatccaactctgtccttc
ttaacaacctggcttgcaataagtaatagtttttgtaactgtgtaatatacagcctctcc
aacagcgttttccggctaggcctccgaagactgtctgagacaatgtgcacatcctgtatg
tgtgtgaaggatcaggaagcacaagaacccaaacctaggaaacgggctaattcttgctcc
atttga

DBGET integrated database retrieval system