KEGG   Homo sapiens (human): 9294Help
Entry
9294              CDS       T01001                                 

Gene name
S1PR2, AGR16, DFNB68, EDG-5, EDG5, Gpcr13, H218, LPB2, S1P2
Definition
(RefSeq) sphingosine-1-phosphate receptor 2
  KO
K04292  sphingosine 1-phosphate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00605  Deafness, autosomal recessive
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967 D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    9294 (S1PR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9294 (S1PR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9294 (S1PR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    9294 (S1PR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 9294
NCBI-ProteinID: NP_004221
OMIM: 605111
HGNC: 3169
Ensembl: ENSG00000267534
Vega: OTTHUMG00000180399
Pharos: O95136(Tchem)
UniProt: O95136 A0A024R7B2
Position
19p13.2
AA seq 353 aa AA seqDB search
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttgtactcggagtacctgaaccccaacaaggtccaggaacactataattat
accaaggagacgctggaaacgcaggagacgacctcccgccaggtggcctcggccttcatc
gtcatcctctgttgcgccattgtggtggaaaaccttctggtgctcattgcggtggcccga
aacagcaagttccactcggcaatgtacctgtttctgggcaacctggccgcctccgatcta
ctggcaggcgtggccttcgtagccaataccttgctctctggctctgtcacgctgaggctg
acgcctgtgcagtggtttgcccgggagggctctgccttcatcacgctctcggcctctgtc
ttcagcctcctggccatcgccattgagcgccacgtggccattgccaaggtcaagctgtat
ggcagcgacaagagctgccgcatgcttctgctcatcggggcctcgtggctcatctcgctg
gtcctcggtggcctgcccatccttggctggaactgcctgggccacctcgaggcctgctcc
actgtcctgcctctctacgccaagcattatgtgctgtgcgtggtgaccatcttctccatc
atcctgttggccatcgtggccctgtacgtgcgcatctactgcgtggtccgctcaagccac
gctgacatggccgccccgcagacgctagccctgctcaagacggtcaccatcgtgctaggc
gtctttatcgtctgctggctgcccgccttcagcatcctccttctggactatgcctgtccc
gtccactcctgcccgatcctctacaaagcccactactttttcgccgtctccaccctgaat
tccctgctcaaccccgtcatctacacgtggcgcagccgggacctgcggcgggaggtgctt
cggccgctgcagtgctggaggccgggggtgggggtgcaaggacggaggcggggcgggacc
ccgggccaccacctcctgccactccgcagctccagctccctggagaggggcatgcacatg
cccacgtcacccacgtttctggagggcaacacggtggtctga

DBGET integrated database retrieval system