KEGG   Homo sapiens (human): 92960
Entry
92960             CDS       T01001                                 
Symbol
PEX11G, PEX11gamma
Name
(RefSeq) peroxisomal biogenesis factor 11 gamma
  KO
K13353  peroxin-11C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    92960 (PEX11G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    92960 (PEX11G)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   92960 (PEX11G)
SSDB
Motif
Pfam: PEX11
Other DBs
NCBI-GeneID: 92960
NCBI-ProteinID: NP_542393
OMIM: 607583
HGNC: 20208
Ensembl: ENSG00000104883
Vega: OTTHUMG00000182044
Pharos: Q96HA9(Tbio)
UniProt: Q96HA9
Position
19:complement(7476875..7494977)
AA seq 241 aa
MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCR
TILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV
DSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQS
EALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATT
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcgtcgctgagcggcctggcgtcggcgctggagtcgtacaggggccgggaccgcctg
atccgagtgctggggtactgctgccagctggttggtggagttctggttgaacagtgtccc
gccaggtccgaagtggggacacgtctgttggtggtgtccacccaactcagccactgcagg
accatcttgcgactctttgatgacctggccatgtttgtctacactaagcaatatggcctg
ggggcacaggaggaggacgcctttgtccgctgtgtctccgtcctagggaacctggctgac
cagctctactacccctgtgagcacgtggcctgggcggctgatgcccgggtcctccacgtg
gactcttctcggtggtggacgctgagtacaaccctgtgggccctctctctgctcctgggg
gttgccaggtccctgtggatgctgctgaaactgagacagaggctgcggagccccacggcg
cccttcaccagcccgctgccccggggcaagcggagggccatggaggcgcagatgcagtcg
gaggcgctgtcacttctcagcaacctggccgacctggccaacgccgtgcactggctgccc
cggggcgtgctgtgggccggccgcttcccgccgtggctagtgggcctcatgggcaccatc
tcctcaatcctcagcatgtaccaggcggcccgggccggcggccaggccgaggccactacc
ccctga

DBGET integrated database retrieval system