KEGG   Homo sapiens (human): 93035Help
Entry
93035             CDS       T01001                                 

Gene name
PKHD1L1, PKHDL1
Definition
(RefSeq) PKHD1 like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TIG G8 Beta_helix PA14 GLEYA
Motif
Other DBs
NCBI-GeneID: 93035
NCBI-ProteinID: NP_803875
OMIM: 607843
HGNC: 20313
Ensembl: ENSG00000205038
Vega: OTTHUMG00000164934
Pharos: Q86WI1(Tdark)
UniProt: Q86WI1
Position
8q23.1-q23.2
AA seq 4243 aa AA seqDB search
MGHLWLLGIWGLCGLLLCAADPSTDGSQIIPKVTEIIPKYGSINGATRLTIRGEGFSQAN
QFNYGVDNAELGNSVQLISSFQSITCDVEKDASHSTQITCYTRAMPEDSYTVRVSVDGVP
VTENNTCKGHINSWECTFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNIALS
SNGKNVRILRVYIGGMPCELLIPQSDNLYGLKLDHPNGDMGSMVCKTTGTFIGHHNVSFI
LDNDYGRSFPQKMAYFVSSLNKIAMFQTYAEVTMIFPSQGSIRGGTTLTISGRFFDQTDF
PVRVLVGGEPCDILNVTENSICCKTPPKPHILKTVYPGGRGLKLEVWNNSRPIRLEEILE
YNEKTPGYMGASWVDSASYIWLMEQDTFVARFSGFLVAPDSDVYRFYIKGDDRYAIYFSQ
TGLPEDKVRIAYHSANANSYFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQ
YRNVYTEQQTGDAVNEEQVIKSQSTILQEVQVITLENWETTNAINEVQKIKVTSPCVEAN
SCSLYQYRLIYNMEKTVFLPADASEFILQSALNDLWSIKPDTVQVIRTQNPQSYVYMVTF
ISTRGDFDLLGYEVVEGNNVTLDITEQTKGKPNLETFTLNWDGIASKPLTLWSSEAEFQG
AVEEMVSTKCPPQIANFEEGFVVKYFRDYETDFNLEHINRGQKTAETDAYCGRYSLKNPA
VLFDSADVKPNRRPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDNSKITRSTDTQFTY
NFAYGNNWTYTCIDLLDLVRTKYTGTNVSLQRISLHKASESQSFYVDVVYIGHTSTISTL
DEMPKRRLPALANKGIFLEHFQVNQTKTNGPTMTNQYSVTMTSYNCSYNIPMMAVSFGQI
ITHETENEFVYRGNNWPGESKIHIQRIQAASPPLSGSFDIQAYGHILKGLPAAVSAADLQ
FALQSLEGMGRISVTREGTCAGYAWNIKWRSTCGKQNLLQINDSNIIGEKANMTVTRIKE
GGLFRQHVLGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDSNITPLVLAISPSQGSYE
EGTILTIVGSGFSPSSAVTVSVGPVGCSLLSVDEKELKCQILNGSAGHAPVAVSMADVGL
AQNVGGEEFYFVYQSQISHIWPDSGSIAGGTLLTLSGFGFNENSKVLVGNETCNVIEGDL
NRITCRTPKKTEGTVDISVTTNGFQATARDAFSYNCLQTPIITDFSPKVRTILGEVNLTI
KGYNFGNELTQNMAVYVGGKTCQILHWNFTDIRCLLPKLSPGKHDIYVEVRNWGFASTRD
KLNSSIQYVLEVTSMFPQRGSLFGGTEITIRGFGFSTIPAENTVLLGSIPCNVTSSSENV
IKCILHSTGNIFRITNNGKDSVHGLGYAWSPPVLNVSVGDTVAWHWQTHPFLRGIGYRIF
SVSSPGSVIYDGKGFTSGRQKSTSGSFSYQFTSPGIHYYSSGYVDEAHSIFLQGVINVLP
AETRHIPLHLFVGRSEATYAYGGPENLHLGSSVAGCLATEPLCSLNNTRVKNSKRLLFEV
SSCFSPSISNITPSTGTVNELITIIGHGFSNLPWANKVTIGSYPCVVEESSEDSITCHID
PQNSMDVGIRETVTLTVYNLGTAINTLSNEFDRRFVLLPNIDLVLPNAGSTTGMTSVTIK
GSGFAVSSAGVKVLMGHFPCKVLSVNYTAIECETSPAAQQLVDVDLLIHGVPAQCQGNCT
FSYLESITPYITGVFPNSVIGSVKVLIEGEGLGTVLEDIAVFIGNQQFRAIEVNENNITA
LVTPLPVGHHSVSVVVGSKGLALGNLTVSSPPVASLSPTSGSIGGGTTLVITGNGFYPGN
TTVTIGDEPCQIISINPNEVYCRTPAGTTGMVDVKIFVNTIAYPPLLFTYALEDTPFLRG
IIPSRGPPGTEIEITGSNFGFEILEISVMINNIQCNVTMANDSVVQCIVGDHAGGTFPVM
MHHKTKGSAMSTVVFEYPLNIQNINPSQGSFGGGQTMTVTGTGFNPQNSIILVCGSECAI
DRLRSDYTTLLCEIPSNNGTGAEQACEVSVVNGKDLSQSMTPFTYAVSLTPLITAVSPKR
GSTAGGTRLTVVGSGFSENMEDVHITIAEAKCDVEYSNKTHIICMTDAHTLSGWAPVCVH
IRGVGMAKLDNADFLYVDAWSSNFSWGGKSPPEEGSLVVITKGQTILLDQSTPILKMLLI
QGGTLIFDEADIELQAENILITDGGVLQIGTETSPFQHKAVITLHGHLRSPELPVYGAKT
LAVREGILDLHGVPVPVTWTRLAHTAKAGERILILQEAVTWKPGDNIVIASTGHRHSQGE
NEKMTIASVSADGINITLSNPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSDNV
EWNNKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCVMFHAPVPGANMVTGRIEYV
EVFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYD
IKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAVAGGT
HFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTS
TVPAPAIFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPYVGGWGETN
GAVIKNAKIVGHLDELGMGSAFCTAKGLVLPFSEGLTVSSVHFMNFDRPNCVALGVTSIS
GVCNDRCGGWSAKFVDVQYSHTPNKAGFRWEHEMVMIDVDGSLTGHKGHTVIPHSSLLDP
SHCTQEAEWSIGFPGSVCDASVSFHRLAFNQPSPVSLLEKDVVLSDSFGTSIIPFQKKRL
THMSGWMALIPNANHINWYFKGVDHITNISYTSTFYGFKEEDYVIISHNFTQNPDMFNII
DMRNGSSNPLNWNTSKNGDWHLEANTSTLYYLVSGRNDLHQSQLISGNLDPDVKDVVINF
QAYCCILQDCFPVHPPSRKPIPKKRPATYNLWSNDSFWQSSRENNYTVPHPGANVIIPEG
TWIVADIDMPSMERLIIWGVLELEDKYNVGAAESSYREVVLNATYISLQGGRLIGGWEDN
PFKGDLKIVLRGNHTTQDWALPEGPNQGAKVLGVFGELDLHGIPHSIYKTKLSETAFAGS
KVLSLMDAVDWQEGEEIVITTTSYDFHQTETRSIVKILHDHKILILNDSLSYTHFAEKYH
VPGTGESYTLAADVGILSRNIKIVGEDYPGWSEDSFGARVLVGSFTENMMTFKGNARISN
VEFYHSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIRGCAFHHGFSPAIGVFGTDGLDI
DDNIIHFTVGEGIRIWGNANRVRGNLIALSVWPGTYQNRKDLSSTLWHAAIEINRGTNTV
LQNNVVAGFGRAGYRIDGEPCPGQFNPVEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFT
IWTCWDYGIYFQTTESVHIYNVTLVDNGMAIFPMIYMPAAISHKISSKNVQIKSSLIVGS
SPGFNCSDVLTNDDPNIELTAAHRSPRSPSGGRSGICWPTFASAHNMAPRKPHAGIMSYN
AISGLLDISGSTFVGFKNVCSGETNVIFITNPLNEDLQHPIHVKNIKLVDTTEQSKIFIH
RPDISKVNPSDCVDMVCDAKRKSFLRDIDGSFLGNAGSVIPQAEYEWDGNSQVGIGDYRI
PKAMLTFLNGSRIPVTEKAPHKGIIRDSTCKYLPEWQSYQCFGMEYAMMVIESLDPDTET
RRLSPVAIMGNGYVDLINGPQDHGWCAGYTCQRRLSLFHSIVALNKSYEVYFTGTSPQNL
RLMLLNVDHNKAVLVGIFFSTLQRLDVYVNNLLVCPKTTIWNAQQKHCELNNHLYKDQFL
PNLDSTVLGENYFDGTYQMLYLLVKGTIPVEIHTATVIFVSFQLSVATEDDFYTSHNLVK
NLALFLKIPSDKIRISKIRGKSLRRKRSMGFIIEIEIGDPPIQFISNGTTGQMQLSELQE
IAGSLGQAVILGNISSILGFNISSMSITNPLPSPSDSGWIKVTAQPVERSAFPVHHVAFV
SSLLVITQPVAAQPGQPFPQQPSVKATDSDGNCVSVGITALTLRAILKDSNNNQVNGLSG
NTTIPFSSCWANYTDLTPLRTGKNYKIEFILDNVVGVESRTFSLLAESVSSSGSSSSSNS
KASTVGTYAQIMTVVISCLVGRMWLLEIFMAAVSTLNITLRSY
NT seq 12732 nt NT seq  +upstreamnt  +downstreamnt
atgggacacctgtggctcctgggtatttggggcctctgtgggctgctcctgtgtgccgcg
gatcccagcacagatggctctcaaataatccccaaagtcacagaaataatacctaaatat
ggcagtataaatggagcaacaaggctgactataagaggggaaggtttttctcaagcaaac
cagtttaactatggagttgataacgctgagttgggaaacagtgtgcaattaatttcttct
ttccagtcaattacttgtgatgtagaaaaagatgcaagtcattcaactcaaattacatgc
tatactagagcaatgccggaagattcctacactgttagagtcagtgtggacggggttcct
gttacggaaaataacacctgcaaaggtcacatcaacagctgggaatgtaccttcaacgca
aaaagttttagaaccccaacaataagaagcatcacacctttatctggaactccaggtaca
ctaataacaatccaaggcagaatcttcactgatgtctatggaagtaatattgcactaagc
tcaaatgggaaaaatgttaggattttgagagtttacattggaggaatgccctgtgagctt
ctcataccacaatctgataatttatatggtctaaaactggatcatccaaatggagatatg
ggttctatggtttgtaagacgactggaacttttattggtcatcacaatgtcagcttcatc
ttagataatgattatggaaggagttttccacagaaaatggcatattttgtttcttctctc
aataaaattgcaatgtttcaaacatatgcagaggtcaccatgattttcccttcacaagga
agcattcgaggtggcaccacgctgacaataagtgggcgtttctttgatcagacagatttc
cccgtcagagttctagttggaggtgaaccttgtgatattttgaatgtcacagaaaatagt
atatgttgcaagacaccccccaaacctcatattctcaaaactgtatatccaggagggaga
ggcctgaagcttgaggtgtggaataatagccgtccaatacgtttggaagagatactggaa
tacaatgaaaaaacgcctgggtacatgggtgccagttgggtagattcagcttcctatatt
tggctcatggaacaagacacatttgttgcacgctttagtggatttttggtggctccagat
tctgatgtttatagattctacatcaagggtgatgaccgttatgctatttattttagccag
actggacttccagaagataaggtgaggattgcatatcattctgctaatgccaacagttat
ttttccagtccaacacaaagatcagatgatattcatctgcagaaaggaaaagaatactat
attgaaatcttgctgcaggagtacagattaagtgcatttgttgatgttggactgtaccag
tatcgaaatgtttatactgaacaacaaacaggagatgcagtgaatgaagaacaagttatc
aaatcccagtcgacaatcctccaggaagtacaggttataacattggaaaactgggaaaca
actaatgcaattaatgaggttcagaagatcaaggtaaccagcccatgtgtggaagctaat
tcatgttcactttaccaatatagattaatctataatatggaaaaaactgtcttcctacct
gctgatgcttctgaattcatactgcaatcagccttgaatgacctctggtctataaaaccg
gacacagttcaagtaataagaacacaaaatccccagagctatgtctacatggtaacattc
atatcaactagaggagactttgatctgcttggttatgaagtagttgaagggaataatgtc
acactggatattacagaacaaaccaaaggaaaacccaacttggagacattcacactgaat
tgggatgggatcgcttctaagccactcactctatggtcatcagaagctgaatttcaggga
gcagtggaagaaatggttagcactaagtgtccaccacaaattgcaaattttgaagaagga
tttgttgtgaaatatttcagagactatgaaactgattttaatctggaacatattaacaga
gggcagaagacagctgaaaccgatgcttactgtggtcgttattccctgaaaaacccagct
gttctttttgactcagcagatgttaaaccaaacagacgaccatatggagatattttattg
tttccttataatcagttatgtttagcatacaaaggattcctggcaaattatattggtcta
aaatttcagtaccaagacaatagcaagattactagaagcactgatacacagtttacatac
aactttgcttatggaaacaactggacttacacttgcatagaccttctggatctcgtaaga
acgaaatacactgggacaaatgtttctcttcagaggattagcttacataaagcatcagaa
tcacagtccttctatgtggatgtagtgtacattggacacacatctacaatctcaacattg
gatgaaatgcccaagagaagacttcctgcattagcaaataaaggaatattcttagagcac
tttcaggtgaatcagaccaaaacaaatgggccaactatgacaaaccaatattctgttacc
atgacttcatacaattgcagttacaatatacccatgatggctgtgagctttgggcagata
atcacacatgagacagagaacgagtttgtctacagaggaaataattggccaggcgagtca
aaaattcatattcaaagaattcaagctgcatctccacctctaagtggcagctttgacatt
caagcttatggacatattcttaaaggcctccccgctgctgtgtcagctgcagatctgcag
tttgcactccagagtctggagggaatgggaagaatctcagttacacgagagggaacctgt
gctggctacgcgtggaacatcaaatggagaagcacctgcggaaagcagaatcttctacag
attaatgattccaacattattggagaaaaggctaatatgacagttacaaggataaaggaa
ggtggcttattcagacaacatgtacttggagacctacttcgtacacccagtcaacagcca
caggttgaagtctatgtcaatggaattccagctaaatgttcaggtgactgtggatttaca
tgggattccaacattactcccctagtcttggcgataagcccttctcaagggtcctatgaa
gaaggcacaattctaaccatagtgggttctggattttctcctagttcagctgtaacagtc
tcagttggaccagtaggttgttctcttctttctgtggatgaaaaagagctcaagtgccag
attctgaatggaagtgctggacatgcccccgttgctgtgtccatggctgatgttggacta
gcacagaatgtagggggtgaagagttctactttgtttatcagagtcagatctcacatatc
tggcctgattctggaagcatagcaggtggtactctactgactttatctggatttggcttt
aatgaaaattcaaaggtattagttggaaatgaaacctgcaatgtgattgaaggggatttg
aataggataacctgcaggacaccaaaaaaaactgagggtacagttgatatttcagttact
accaatggatttcaagccacagcaagggatgcttttagttataattgtttacagacacca
attataactgattttagtccaaaagtacgaacaatactaggagaagttaatttaacaatt
aagggctataattttggaaatgaactcacacaaaacatggcggtgtatgttggaggaaaa
acctgccagattcttcactggaacttcacagatattagatgccttttgcccaagttgtct
cctggaaaacatgatatctatgtagaagtcagaaactggggttttgcatcaacaagagac
aaattaaattcttcaatacagtatgttttagaagtgaccagcatgtttccacaaagaggc
tccttgtttggtggaactgaaatcaccataaggggttttggattcagcacaataccagct
gagaataccgtgctgttagggtccatcccttgcaatgttacatcatcatcagaaaatgtc
ataaaatgtattcttcattcaactgggaatatattcaggattaccaacaatgggaaagat
tcagtacatggattaggttatgcctggtcaccaccagtcctaaatgtgtctgtgggggac
acagtggcatggcattggcaaacacatccgtttcttagagggataggatataggattttt
tctgtctccagtcctggaagtgtaatttatgatggcaaaggattcacaagtggaagacaa
aaatctacatcaggttcattttcttaccaatttacttctcctggaatccattattatagc
agcgggtatgttgatgaggctcactccatttttctccaaggagtcattaatgttttacca
gctgaaaccagacacattcccttgcacctgtttgtgggtcgctctgaagccacatatgct
tatggaggacctgagaatttgcacttgggaagctctgtggcaggctgcctagcaacagaa
cccctgtgcagcctgaacaataccagggttaaaaattcaaaaagattgctatttgaggtt
tcaagttgtttttcaccatctataagcaacattactccgtccactggaacagtaaatgaa
ctaataacaattattggacatggctttagtaatctcccatgggctaataaggttacaatt
ggtagctacccctgtgtcgtagaagaaagtagtgaggattcaattacatgtcatattgac
cctcaaaactcaatggatgttggtatcagggaaactgtcactttgactgtctacaacctg
ggcactgctatcaatacgttgtccaatgaatttgataggcgatttgtacttttgccaaac
attgacctggtgttgccaaatgcaggatcaactacaggaatgacaagcgtgaccataaaa
ggctctggatttgccgtttcttctgcaggtgtaaaagtccttatgggtcatttcccatgt
aaagttctatcagtgaattatacggccattgaatgtgaaacatcccctgctgcccaacag
cttgtggatgtagatcttctaatacatggagtgcctgcccagtgccagggaaactgcacc
ttttcatacttagaaagcatcactccttacataacaggagtcttcccaaactctgtcata
ggatctgtaaaagttcttattgaaggagaaggtttggggactgttttggaggacattgct
gttttcattggaaatcaacagttcagagcaatagaggttaatgaaaacaacatcactgct
cttgtgactcctctcccagttggacatcattctgttagtgttgtggtgggaagtaaaggc
ttggctctgggaaacctgactgtcagcagccccccagtagcatctctatcaccaacttct
ggaagcattggtggtggaactacactggtgatcacaggaaatggcttctatccaggcaac
actacagtcactattggggatgaaccttgtcaaattatttccatcaaccccaatgaagtc
tactgccgcactcccgctgggaccactggaatggtcgatgttaaaatctttgttaataca
attgcttatccacctttgctttttacatatgccctggaggatactccatttctcagagga
attatcccaagcagaggtccaccaggaactgaaattgagatcactggatccaactttggc
tttgagatcttggaaatctccgtgatgataaataacattcagtgtaatgtaaccatggcc
aatgatagtgtggtgcagtgcatcgtgggagatcatgctgggggcacatttcctgttatg
atgcatcataagacaaaaggctcagccatgtccacagttgtatttgagtacccgcttaat
attcaaaatattaatccaagccaagggagctttggtgggggtcaaaccatgactgtgaca
ggcaccggatttaatccacaaaattcaattatattagtttgtggctcagaatgtgcaatt
gacaggcttagatctgattacacaacactattatgtgaaattccatctaataatggcacg
ggagctgagcaagcctgtgaagtgagtgtggttaatgggaaagatttgtcacagtccatg
actccgtttacgtacgcagtgtcactgactccactcatcactgcagtatctcctaagaga
ggcagtacagcagggggcaccagactgacagtcgtgggatcaggattcagtgaaaatatg
gaggatgttcatatcaccatagctgaagccaaatgtgatgttgagtattccaacaagaca
cacatcatctgcatgacagatgcccatactctatcagggtgggctccagtttgtgtccac
atcagaggtgtcggcatggccaaactggataatgctgactttctttatgttgatgcctgg
tcctccaatttctcatgggggggaaaatctcccccagaagaaggatctcttgttgttatt
acaaaaggacagaccattctgctggatcaaagcacccctattttgaaaatgttgcttatt
cagggtgggactctaatatttgatgaagctgacattgaactccaggcagaaaatattcta
attacagatggaggtgttcttcagattggaacagagacatccccattccaacacaaggct
gtcattaccttgcatggtcacctgcgatctcctgagctccctgtctatggtgccaaaaca
ctggctgtgcgggagggaatcctggatctgcacggtgtgcctgttcctgtgacctggact
cgcttggctcatactgcaaaggcaggggaaagaattttaattttacaagaagcagtaaca
tggaaaccaggagataacattgtaattgcaagcacaggacacagacacagtcaaggagag
aatgaaaaaatgaccattgcatctgtgtctgctgatggcataaacataacactaagtaac
ccactaaattacacacacttaggaattacggtcacactccctgatggaactctgtttgaa
gcaagagcagaagttggaattcttacaagaaatattttaataagaggatctgataatgtt
gagtggaataacaaaattcctgcatgtcctgatggatttgacacaggagaatttgctaca
cagacctgtctccaaggaaagtttggagaagaaataggaagtgaccaatttggaggctgc
gttatgtttcatgctcctgtacctggtgctaacatggtaactgggagaatagaatatgta
gaggtattccatgctggccaggctttccggttggggcgatatccaatacattggcacctg
cttggagacttacagtttaaatcttatgtaagaggctgtgcaattcaccaggcctataac
agagctgttactattcataacacacaccatcttctggttgagaggaatattatatatgat
attaagggaggagcattttttatagaagatggtattgaacatggcaatatcctccagtat
aacttggcagtatttgtacagcaaagtaccagtcttctgaatgatgatgtgaccccggct
gcattttgggtcaccaacccgaacaataccatacgacacaatgctgttgctggtggcact
cactttggcttttggtaccggatgaacaaccaccctgatgggccatcctatgacagaaac
atttgtcaaaaaagagttccccttggcgaattttttaacaatactgtccattctcaaggt
tggtttggaatgtggatctttgaggaatatttccccatgcaaacgggatcttgtacatct
acagtgcctgcacctgcaatatttaactcacttactacttggaattgtcaaaaaggagct
gaatgggtcaatggaggtgcccttcagttccataactttgtgatggtgaataactatgag
gctggaattgagactaagaggatcctggctccttatgttggagggtggggtgaaaccaat
ggagcggtgattaaaaatgccaaaatagtcggccatcttgatgaactgggaatggggtct
gcattttgcacagcaaaaggcctggttctcccatttagtgaaggcttgactgtctcttct
gtgcactttatgaactttgaccgtcccaactgtgtagctttgggagtgacatccatctct
ggagtttgtaatgacagatgtgggggttggagtgcaaagtttgttgacgtccagtattct
cacacaccgaacaaggctggctttcgctgggaacatgaaatggtaatgattgatgttgat
ggctcacttacagggcacaaaggacataccgtcattccacacagctcattgctagaccct
tctcattgtactcaggaagctgagtggagcattgggttccctggatcagtctgtgatgct
tcagtcagctttcaccgtttagcgttcaaccagccttctccagtatctctgcttgaaaag
gatgtggttctttcagactcttttggcacaagcattattccatttcagaagaaacgactg
actcatatgtctggatggatggctctgattccaaatgcaaatcacattaactggtatttt
aaaggtgtggatcacataaccaacatttcatatacatcgacattctatggattcaaggaa
gaagactatgtaattatatcacataacttcactcaaaatcctgacatgtttaatattatt
gatatgaggaatggttcctcaaatccattgaattggaatactagcaagaatggggactgg
caccttgaagcaaacactagtactctatattacttggtgtcaggaagaaatgaccttcat
cagagtcagctcatttctgggaacctggatcctgatgtgaaagacgttgttattaatttc
caagcttactgttgtattctccaggattgctttcctgtacatccgccatcaagaaaacca
attcccaagaagcgaccagccacatataatttatggtcaaatgattctttttggcaatca
tcacgagaaaataattatactgtacctcacccaggggcaaatgtgattatacctgaagga
acatggattgtagctgacatagatatgccatcaatggaaagactcattatttggggggtt
ctagaactggaagataaatacaatgtaggagctgcagaatcttcttacagagaagttgtt
ttgaatgctacctacatatcactgcagggaggtagattaatcggtggctgggaagataac
ccttttaaaggagacttaaagattgttcttagaggaaatcatactacacaagactgggct
cttccagaaggaccaaatcaaggggcaaaggtcttaggggtgtttggtgagctggatctt
catggaattccacattcaatatataaaactaagctctcagaaactgcatttgcaggttcc
aaagtcctgtctctgatggatgctgtggattggcaggagggagaagagattgtgataaca
accacaagctacgatttccaccagacagaaacaagaagtatcgttaaaatcctgcatgat
cataaaattctcattcttaatgatagcctttcctatactcactttgctgaaaaataccat
gtccctggaactggtgagagctacacgttagcagctgatgttgggatactgagtaggaac
atcaaaatagttggtgaagattaccccggttggtctgaggactcttttggagcacgcgta
ctggttggctcattcactgaaaatatgatgacatttaaaggaaatgcaagaataagtaat
gtggaattttatcacagtggtcaagaaggcttcagggatagcacagatccaagatatgct
gtaacgtttcttaacctaggacagattcaagaacatggctcatcttatattcgaggctgt
gcttttcaccatggcttctctccagcaattggtgtatttgggacagatggattggacata
gatgacaacatcattcactttacagtgggggaaggcataagaatatgggggaatgccaac
cgagtccgagggaatttgattgcactttcggtttggccaggaacctatcagaacagaaaa
gatttaagttcaactctctggcatgcagcaattgagataaatagagggaccaatacagtt
ttacagaataatgtagtggctggatttggaagagcaggataccgcattgatggtgaacct
tgcccaggccagtttaatcctgtggaaaagtggtttgacaatgaagcccatggaggttta
tatgggatctatatgaaccaagatggccttcctggatgttctcttatacaaggatttacc
atttggacatgctgggattatggaatttattttcagaccacagagagtgtgcacatttat
aatgtgaccctggttgacaatggaatggccatttttccaatgatttacatgccagctgct
atatcacacaaaatttccagtaaaaatgtacaaattaagagctcattaattgttggaagt
agccctgggtttaattgctctgatgtcctaactaatgatgatcctaatattgaactcact
gctgctcatcggagtcctagatctccatcaggtgggagaagtgggatttgttggcctacc
tttgcttcagctcataacatggcaccccgaaagccccatgcaggaatcatgagttacaat
gccatcagtggccttttggacatctcaggttcaacatttgttggatttaagaatgtttgt
tcaggggaaactaatgttatattcattactaaccctttaaatgaggatttacagcatcca
atccatgtgaagaatataaaactggttgataccactgaacaatcaaaaatatttatacat
aggcctgatataagtaaggtcaatccatctgattgtgtagacatggtttgtgatgccaag
aggaaatcttttcttagagacatagatggctcctttctggggaatgctggttctgtgata
cctcaagcagaatatgaatgggacggaaacagccaagtaggaattggagactacagaatt
cctaaggcgatgctcacattcttgaatggaagtagaattcctgtcactgagaaagcacct
cataaaggaattattagagattcaacctgtaagtaccttccagagtggcagagctatcag
tgctttgggatggaatatgcaatgatggttattgaaagtctggatcctgacacagaaact
cgaagactttccccagtggctataatgggcaacggttatgttgatcttattaatggccca
caggatcatggctggtgtgctggatatacatgccagagaaggctgtccctgtttcacagc
attgtggctctgaacaaatcttatgaagtttacttcactggcaccagtcctcagaatctt
cgactgatgttgcttaatgttgatcataacaaggctgttctagtaggaattttcttttcc
acacttcaacgtttggatgtctatgtgaacaacttattggtctgtccaaaaactacaata
tggaatgcccagcagaaacactgtgaacttaataaccatctgtacaaagaccaattcctt
cctaacctggattccactgtccttggtgaaaactactttgatggaacctaccagatgctt
tatcttttggttaaaggaactatacctgttgaaattcacactgccacagtgatatttgtt
tctttccaattatctgttgcaacagaagatgacttttatacctctcacaatctggttaaa
aatcttgccttgttcctaaagataccaagtgacaaaatccgtatcagcaaaataagaggg
aagagtctgaggaggaagagatccatgggattcataattgaaatagagattggagaccct
cctattcagttcataagcaatggcaccacaggtcagatgcagttatctgaactccaggaa
attgctggttctcttggacaagctgtaattttaggaaacatcagtagtatccttggattt
aacatttcgtccatgtctattactaatcccctccccagcccaagtgactctgggtggatt
aaggtgactgcccagccagttgaaaggtctgcatttcctgttcatcacgtggccttcgtg
tcctcactcttagtgatcactcagccggtggcagcacagccaggacagccatttcctcag
cagccttcggtaaaggcaacagattctgacggtaactgtgtatcagttggaattactgca
ctaactttgagggccatactcaaggactccaataataaccaagtcaatggccttagtgga
aatacaacaattccgtttagcagctgttgggccaactacacagaccttactccccttaga
acaggaaaaaattataagattgaatttatactggataatgttgttggggtagaatccaga
actttcagcctgctggcagagtctgtctctagcagtggcagcagcagcagcagcaacagc
aaagcatcaactgtgggtacatatgcccagataatgactgtagtaattagctgtctggtt
ggaagaatgtggctcttggaaatatttatggctgcagtttcaactttgaatataacttta
agaagctactaa

DBGET integrated database retrieval system