KEGG   Homo sapiens (human): 9308
Entry
9308              CDS       T01001                                 

Gene name
CD83, BL11, HB15
Definition
(RefSeq) CD83 molecule
  KO
K06510  CD83 antigen
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    9308 (CD83)
CD molecules [BR:hsa04090]
 Proteins
  9308 (CD83)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 Ig_6
Other DBs
NCBI-GeneID: 9308
NCBI-ProteinID: NP_004224
OMIM: 604534
HGNC: 1703
Ensembl: ENSG00000112149
Vega: OTTHUMG00000014283
Pharos: Q01151(Tbio)
UniProt: Q01151
Structure
PDB: 
5MIX 5MJ1 5MJ2 5MJ0

Position
6p23
AA seq 205 aa
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGLVTPHKTELV
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtcgcgcggcctccagcttctgctcctgagctgcgcctacagcctggctcccgcgacg
ccggaggtgaaggtggcttgctccgaagatgtggacttgccctgcaccgccccctgggat
ccgcaggttccctacacggtctcctgggtcaagttattggagggtggtgaagagaggatg
gagacaccccaggaagaccacctcaggggacagcactatcatcagaaggggcaaaatggt
tctttcgacgcccccaatgaaaggccctattccctgaagatccgaaacactaccagctgc
aactcggggacatacaggtgcactctgcaggacccggatgggcagagaaacctaagtggc
aaggtgatcttgagagtgacaggatgccctgcacagcgtaaagaagagacttttaagaaa
tacagagcggagattgtcctgctgctggctctggttattttctacttaacactcatcatt
ttcacttgtaagtttgcacggctacagagtatcttcccagatttttctaaagctggcatg
gaacgagcttttctcccagttacctccccaaataagcatttagggctagtgactcctcac
aagacagaactggtatga

DBGET integrated database retrieval system