KEGG   Homo sapiens (human): 93081
Entry
93081             CDS       T01001                                 
Symbol
TEX30, C13orf27
Name
(RefSeq) testis expressed 30
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Abhydrolase_11 DLH Hydrolase_4 Abhydrolase_5 FSH1 Abhydrolase_4 Peptidase_S9
Other DBs
NCBI-GeneID: 93081
NCBI-ProteinID: NP_620134
HGNC: 25188
Ensembl: ENSG00000151287
Pharos: Q5JUR7(Tdark)
UniProt: Q5JUR7 A0A024RDZ1
Position
13:complement(102765888..102773786)
AA seq 227 aa
MSHTEVKLKIPFGNKLLDAVCLVPNKSLTYGIILTHGASGDMNLPHLMSLASHLASHGFF
CLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDG
DDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQA
PHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagtcatacagaggttaaattaaaaataccttttggaaataaattactagatgctgtt
tgtttggtacctaacaagagcttaacatatggaataattcttacacatggagcatcagga
gatatgaatcttcctcatttgatgtcactggcatcccatcttgcatctcatgggtttttc
tgcctgagatttacctgtaaaggccttaatattgtacatagaattaaggcgtataaatca
gttttgaattacctgaagacatcaggagaatacaaacttgcaggtgtttttcttggaggt
cgttcaatgggctcaagagcagctgcttctgtaatgtgtcacattgagccagatgatggt
gatgattttgttcggggtctcatttgtatttcttacccactgcaccatccaaagcagcag
cataaactcagagatgaagacctctttcgtttaaaagagcctgtactgtttgtgtcaggc
tcagcagatgaaatgtgtgaaaagaacttgttggagaaagtggcacagaaaatgcaagct
ccccataaaatccactggattgagaaggcaaatcattccatggcagtgaaaggacggtcg
acaaatgatgttttcaaagaaataaatacacagattttgttttggatccaagaaattact
gaaatggacaagaaatgtcattag

DBGET integrated database retrieval system