KEGG   Homo sapiens (human): 931Help
Entry
931               CDS       T01001                                 

Gene name
MS4A1, B1, Bp35, CD20, CVID5, LEU-16, MS4A2, S7
Definition
(RefSeq) membrane spanning 4-domains A1
  KO
K06466  B-lymphocyte antigen CD20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
Disease
H00088  Common variable immunodeficiency (CVID)
Drug target
Ibritumomab tiuxetan (90Y): D04489
Obinutuzumab: D09321
Ocaratuzumab: D10482
Ocrelizumab: D05218
Ofatumumab: D09314
Rituximab: D02994
Tositumomab: D08621
Tositumomab/iodine (131I) tositumomab: D08622
Veltuzumab: D09031
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    931 (MS4A1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   931 (MS4A1)
CD molecules [BR:hsa04090]
 Proteins
  931 (MS4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 CM2
Motif
Other DBs
NCBI-GeneID: 931
NCBI-ProteinID: NP_068769
OMIM: 112210
HGNC: 7315
Ensembl: ENSG00000156738
Vega: OTTHUMG00000167614
Pharos: P11836(Tclin)
UniProt: P11836 A0A024R507
Structure
PDB: 

Position
11q12.2
AA seq 297 aa AA seqDB search
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG
LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN
SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST
QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI
EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccagaaattcagtaaatgggactttcccggcagagccaatgaaaggccct
attgctatgcaatctggtccaaaaccactcttcaggaggatgtcttcactggtgggcccc
acgcaaagcttcttcatgagggaatctaagactttgggggctgtccagattatgaatggg
ctcttccacattgccctggggggtcttctgatgatcccagcagggatctatgcacccatc
tgtgtgactgtgtggtaccctctctggggaggcattatgtatattatttccggatcactc
ctggcagcaacggagaaaaactccaggaagtgtttggtcaaaggaaaaatgataatgaat
tcattgagcctctttgctgccatttctggaatgattctttcaatcatggacatacttaat
attaaaatttcccattttttaaaaatggagagtctgaattttattagagctcacacacca
tatattaacatatacaactgtgaaccagctaatccctctgagaaaaactccccatctacc
caatactgttacagcatacaatctctgttcttgggcattttgtcagtgatgctgatcttt
gccttcttccaggaacttgtaatagctggcatcgttgagaatgaatggaaaagaacgtgc
tccagacccaaatctaacatagttctcctgtcagcagaagaaaaaaaagaacagactatt
gaaataaaagaagaagtggttgggctaactgaaacatcttcccaaccaaagaatgaagaa
gacattgaaattattccaatccaagaagaggaagaagaagaaacagagacgaactttcca
gaacctccccaagatcaggaatcctcaccaatagaaaatgacagctctccttaa

DBGET integrated database retrieval system