KEGG   Homo sapiens (human): 93100Help
Entry
93100             CDS       T01001                                 

Gene name
NAPRT, NAPRT1, PP3856
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    93100 (NAPRT)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     93100 (NAPRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAPRTase
Motif
Other DBs
NCBI-GeneID: 93100
NCBI-ProteinID: NP_660202
OMIM: 611552
HGNC: 30450
Ensembl: ENSG00000147813
Vega: OTTHUMG00000156942
Pharos: Q6XQN6(Tbio)
UniProt: Q6XQN6
Structure
PDB: 

Position
8q24.3
AA seq 538 aa AA seqDB search
MAAEQDPEARAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGV
DLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDE
EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQ
GQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagcaggaccccgaggcgcgcgcggcggcgcggccgctgctcactgacctc
taccaggccaccatggcgttgggctattggcgcgcgggccgggcgcgggacgccgccgag
ttcgagctcttcttccgccgctgcccgttcggcggcgccttcgccttggccgccggcttg
cgcgactgtgtgcgcttcctgcgcgccttccgcctgcgggacgccgacgtgcagttcctg
gcctcggtgctgcccccagacacggatcctgcgttcttcgagcaccttcgggccctcgac
tgctccgaggtgacggtgcgagccctgcccgagggctccctcgccttccccggagtgccg
ctcctgcaggtgtccgggccgctcctggtggtgcagctgctggagacaccgctgctctgc
ctggtcagctacgccagcctggtggccaccaacgcagcgcggcttcgcttgatcgcaggg
ccagagaagcggctgctagagatgggcctgaggcgggctcagggccccgatgggggcctg
acagcctccacctacagctacctgggcggcttcgacagcagcagcaacgtgctagcgggc
cagctgcgaggtgtgccggtggccgggaccctggcccactccttcgtcacttccttttca
ggcagcgaggtgccccctgacccgatgttggcgccagcagctggtgagggccctggggtg
gacctggcggccaaagcccaggtgtggctggagcaggtgtgtgcccacctggggctgggg
gtgcaggagccgcatccaggcgagcgggcagcctttgtggcctatgccttggcttttccc
cgggccttccagggcctcctggacacctacagcgtgtggaggagtggtctccccaacttc
ctagcagtcgccctggccctgggagagctgggctaccgggcagtgggcgtgaggctggac
agtggtgacctgctacagcaggctcaggagatccgcaaggtcttccgagctgctgcagcc
cagttccaggtgccctggctggagtcagtcctcatcgtagtcagcaacaacattgacgag
gaggcgctggcccgactggcccaggagggcagtgaggtgaatgtcattggcattggcacc
agtgtggtcacctgcccccaacagccttccctgggtggcgtctataagctggtggccgtg
gggggccagccacgaatgaagctgaccgaggaccccgagaagcagacgttgcctgggagc
aaggctgctttccggctcctgggctctgacgggtctccactcatggacatgctgcagtta
gcagaagagccagtgccacaggctgggcaggagctgagggtgtggcctccaggggcccag
gagccctgcaccgtgaggccagcccaggtggagccactactgcggctctgcctccagcag
ggacagctgtgtgagccgctcccatccctggcagagtctagagccttggcccagctgtcc
ctgagccgactcagccctgagcacaggcggctgcggagccctgcacagtaccaggtggtg
ctgtccgagaggctgcaggccctggtgaacagtctgtgtgcggggcagtccccctga

DBGET integrated database retrieval system