KEGG   Homo sapiens (human): 9311Help
Entry
9311              CDS       T01001                                 

Gene name
ASIC3, ACCN3, DRASIC, SLNAC1, TNaC1
Definition
(RefSeq) acid sensing ion channel subunit 3
  KO
K04830  acid-sensing ion channel 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    9311 (ASIC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    9311 (ASIC3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   9311 (ASIC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 9311
NCBI-ProteinID: NP_004760
OMIM: 611741
HGNC: 101
Ensembl: ENSG00000213199
Vega: OTTHUMG00000158685
Pharos: Q9UHC3(Tchem)
UniProt: Q9UHC3 A0A090N7X8
Position
7q36.1
AA seq 531 aa AA seqDB search
MKPTSGPEEARRPASDIRVFASNCSMHGLGHVFGPGSLSLRRGMWAAAVVLSVATFLYQV
AERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRLTPNDLHWAGSALLGLDPA
EHAAFLRALGRPPAPPGFMPSPTFDMAQLYARAGHSLDDMLLDCRFRGQPCGPENFTTIF
TRMGKCYTFNSGADGAELLTTTRGGMGNGLDIMLDVQQEEYLPVWRDNEETPFEVGIRVQ
IHSQEEPPIIDQLGLGVSPGYQTFVSCQQQQLSFLPPPWGDCSSASLNPNYEPEPSDPLG
SPSPSPSPPYTLMGCRLACETRYVARKCGCRMVYMPGDVPVCSPQQYKNCAHPAIDAMLR
KDSCACPNPCASTRYAKELSMVRIPSRAAARFLARKLNRSEAYIAENVLALDIFFEALNY
ETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQR
HSSTNLLQEGLGSHRTQVPHLSLGPRPPTPPCAVTKTLSASHRTCYLVTQL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccacctcaggcccagaggaggcccggcggccagcctcggacatccgcgtgttc
gccagcaactgctcgatgcacgggctgggccacgtcttcgggccaggcagcctgagcctg
cgccgggggatgtgggcagcggccgtggtcctgtcagtggccaccttcctctaccaggtg
gctgagagggtgcgctactacagggagttccaccaccagactgccctggatgagcgagaa
agccaccggctcatcttcccggctgtcaccctgtgcaacatcaacccactgcgccgctcg
cgcctaacgcccaacgacctgcactgggctgggtctgcgctgctgggcctggatcccgca
gagcacgccgccttcctgcgcgccctgggccggccccctgcaccgcccggcttcatgccc
agtcccacctttgacatggcgcaactctatgcccgtgctgggcactccctggatgacatg
ctgctggactgtcgcttccgtggccaaccttgtgggcctgagaacttcaccacgatcttc
acccggatgggaaagtgctacacatttaactctggcgctgatggggcagagctgctcacc
actactaggggtggcatgggcaatgggctggacatcatgctggacgtgcagcaggaggaa
tatctacctgtgtggagggacaatgaggagaccccgtttgaggtggggatccgagtgcag
atccacagccaggaggagccgcccatcatcgatcagctgggcttgggggtgtccccgggc
taccagacctttgtttcttgccagcagcagcagctgagcttcctgccaccgccctggggc
gattgcagttcagcatctctgaaccccaactatgagccagagccctctgatcccctaggc
tcccccagccccagccccagccctccctatacccttatggggtgtcgcctggcctgcgaa
acccgctacgtggctcggaagtgcggctgccgaatggtgtacatgccaggcgacgtgcca
gtgtgcagcccccagcagtacaagaactgtgcccacccggccatagatgccatgcttcgc
aaggactcgtgcgcctgccccaacccgtgcgccagcacgcgctacgccaaggagctctcc
atggtgcggatcccgagccgcgccgccgcgcgcttcctggcccggaagctcaaccgcagc
gaggcctacatcgcggagaacgtgctggccctggacatcttctttgaggccctcaactat
gagaccgtggagcagaagaaggcctatgagatgtcagagctgcttggtgacattgggggc
cagatggggctgttcatcggggccagcctgctcaccatcctcgagatcctagactacctc
tgtgaggtgttccgagacaaggtcctgggatatttctggaaccgacagcactcccaaagg
cactccagcaccaatctgcttcaggaagggctgggcagccatcgaacccaagttccccac
ctcagcctgggccccagacctcccacccctccctgtgccgtcaccaagactctctccgcc
tcccaccgcacctgctaccttgtcacacagctctag

DBGET integrated database retrieval system