KEGG   Homo sapiens (human): 9313Help
Entry
9313              CDS       T01001                                 

Gene name
MMP20, AI2A2, MMP-20
Definition
(RefSeq) matrix metallopeptidase 20
  KO
K07999  matrix metalloproteinase-20 (enamelysin) [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00615  Amelogenesis imperfecta
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    9313 (MMP20)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     9313 (MMP20)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   9313 (MMP20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Reprolysin_4 Reprolysin_3 DUF4953 Reprolysin_5 Peptidase_M66 Metallopep Peptidase_M50B
Motif
Other DBs
NCBI-GeneID: 9313
NCBI-ProteinID: NP_004762
OMIM: 604629
HGNC: 7167
Ensembl: ENSG00000137674
Vega: OTTHUMG00000168081
Pharos: O60882(Tbio)
UniProt: O60882
Structure
PDB: 

Position
11q22.2
AA seq 483 aa AA seqDB search
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEM
VARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKN
TLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSY
PFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDP
SALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAY
FFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDER
KRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSW
IGC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctccctgcatctggccttgctgtcttcctcatcatggctttgaagttttcc
actgcagccccctccctagttgcagcctcccccaggacctggaggaacaactaccgcctc
gcacaggcgtatcttgacaaatattacacaaataaagaaggacaccagattggtgagatg
gttgcaagaggaagcaattccatgataaggaagattaaggagctacaagcgttctttggc
ctccaagtcaccgggaagttagaccagaccacaatgaacgtgatcaagaagcctcgctgt
ggagttcctgatgtggccaattatcgcctcttccctggtgaacccaaatggaaaaaaaat
actttgacatacagaatatctaaatacacaccttccatgagttctgtcgaggtggacaaa
gcagtggagatggccttgcaggcctggagtagcgccgtccctctgagctttgtcagaata
aactcaggagaagcggatattatgatatcttttgaaaatggagatcacggggattcctat
ccattcgatgggcctcgggggactctagcccatgcatttgctcctggagaaggcctggga
ggagatacacatttcgacaatgctgagaagtggactatgggaacgaatggttttaatttg
tttaccgttgctgctcatgaatttggccatgccctgggcctggcccattccacagaccca
tcagcactgatgtacccaacttataagtacaagaatccctatggattccacctccccaaa
gatgatgtgaaagggatccaggcattatacggacctcggaaagtattcctggggaagccc
actctgccccatgccccccatcacaagccatccatccctgacctctgtgactccagctca
tcctttgacgctgtgacaatgctggggaaggagctcctgctcttcaaggaccggattttc
tggagacggcaggttcacttgcggacaggaattcggcccagcactattaccagctccttc
ccccagctcatgtccaatgtggatgcagcttacgaagtggctgagaggggcactgcttac
ttcttcaaaggtccccactactggataacaagaggattccaaatgcaaggtcctcctcgg
actatttatgactttggatttccaaggcacgtgcagcaaatagatgctgctgtctacctc
agggagccacagaagacccttttctttgtgggagatgaatactacagctacgacgaaagg
aaaaggaaaatggaaaaagactatccaaagaatactgaagaagaattttcaggagtaaat
ggccaaatcgatgctgctgtagaattaaatggctacatttacttcttttcaggaccaaaa
acatacaagtatgacacagagaaggaagatgtggttagtgtggtgaaatctagttcctgg
attggttgctaa

DBGET integrated database retrieval system