KEGG   Homo sapiens (human): 93145Help
Entry
93145             CDS       T01001                                 

Gene name
OLFM2, NOE2, NOELIN2, NOELIN2_V1, OlfC
Definition
(RefSeq) olfactomedin 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: OLF Noelin-1 Helo_like_N ABC_tran_CTD
Motif
Other DBs
NCBI-GeneID: 93145
NCBI-ProteinID: NP_477512
OMIM: 617492
HGNC: 17189
Ensembl: ENSG00000105088
Vega: OTTHUMG00000180390
Pharos: O95897(Tdark)
UniProt: O95897
Position
19p13.2
AA seq 454 aa AA seqDB search
MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDG
RSRELRQLMEKVQNVSQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQ
ELKDRMTELLPLSSVLEQYKADTRTIVRLREEVRNLSGSLAAIQEEMGAYGYEDLQQRVM
ALEARLHACAQKLGCGKLTGVSNPITVRAMGSRFGSWMTDTMAPSADSRVWYMDGYYKGR
RVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLV
QRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVMRS
WDTGYPKRSAGEAFMICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISML
DYNPRERALYTWNNGHQVLYNVTLFHVISTSGDP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtggccgctcacggtcccgccgccgctgctgctgctgctgtgctcaggcctggccgga
cagactctcttccagaacccagaagagggctggcagctgtacacctcagcccaggcccct
gacgggaaatgcatctgcacggccgtgatcccagcgcagagtacctgctctcgagatggc
aggagtcgggagctgcggcaactgatggagaaggtccagaacgtctcccagtccatggag
gtccttgagttgcggacgtatcgcgacctccagtatgtacgcggcatggagaccctcatg
cggagcctggatgcgcggctccgggcagctgatgggtccctctcggccaagagcttccag
gagctgaaggacaggatgacggaactgttgcccctgagctcggtcctggagcagtacaag
gcagacacgcggaccattgtacgcttgcgggaggaggtgaggaatctctccggcagtctg
gcggccattcaggaggagatgggtgcctacgggtatgaggacctgcagcaacgggtgatg
gccctggaggcccggctccacgcctgcgcccagaagctgggctgtgggaagctgaccggg
gtcagtaaccccatcaccgttcgggccatggggtcccgcttcggctcctggatgactgac
acgatggcccccagtgcggatagccgggtctggtacatggatggctattacaaaggccgc
cgggtcctggagttccgtaccctgggagacttcatcaaaggccagaactttatccagcac
ctgctgccccagccgtgggcgggcacgggccacgtggtgtacaacggctccctgttctat
aacaagtaccagagcaacgtggtggtcaaataccacttccgctcgcgctctgtgctggtg
cagaggagcctcccgggcgccggttacaacaacaccttcccctactcctggggcggcttc
tccgacatggacttcatggtggacgagagcgggctctgggctgtgtacaccaccaaccag
aacgcgggcaacatcgtggtcagccggctggacccgcacaccctcgaggtcatgcggtcc
tgggacaccggctaccccaagcgcagcgctggcgaggccttcatgatctgcggtgtgctc
tacgtgaccaactcccacctggctggggccaaggtctacttcgcctattttaccaacacg
tccagttacgagtacacggacgtgcccttccacaaccagtattcccacatctcgatgctg
gattacaacccccgggagcgcgccctctatacctggaacaacggccaccaggtgctctac
aatgtcaccctgtttcacgtcatcagcacctctggggacccctga

DBGET integrated database retrieval system