KEGG   Homo sapiens (human): 932Help
Entry
932               CDS       T01001                                 

Gene name
MS4A3, CD20L, HTM4
Definition
(RefSeq) membrane spanning 4-domains A3
  KO
K22190  membrane-spanning 4-domains subfamily A member 3/4/8/12/15/18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    932 (MS4A3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   932 (MS4A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD20
Motif
Other DBs
NCBI-GeneID: 932
NCBI-ProteinID: NP_006129
OMIM: 606498
HGNC: 7317
Ensembl: ENSG00000149516
Vega: OTTHUMG00000167380
Pharos: Q96HJ5(Tbio)
UniProt: Q96HJ5
Position
11q12.1
AA seq 214 aa AA seqDB search
MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAA
MILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQN
SFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLIL
TLLELCVTISTIAMWCNANCCNSREEISSPPNSV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccacgaagttgataatgcagagctggggtcagcctctgcccatggtacccca
ggcagtgaggcgggaccagaagagctgaatacttctgtctaccagcccatagatggatca
ccagattatcagaaagcaaaattacaagttcttggggccatccagatcctgaatgcagca
atgattctggctttgggtgtctttctgggttccttgcaatacccataccacttccaaaag
cacttctttttcttcaccttctacacaggctacccgatttggggtgctgtgtttttctgt
agttcaggaaccttgtctgttgtagcagggataaaacccacaagaacatggatacagaac
agttttggaatgaacattgccagtgctacaattgcactagtggggactgcttttctctca
ctaaatatagcagttaatatccagtcattaaggagttgtcactcttcatcagagtcaccg
gacctatgcaattacatgggctccatatcaaatggcatggtgtctctactgctgattctc
accttgctggaattatgcgtaaccatctctaccatagccatgtggtgcaatgcaaactgc
tgtaattcaagagaggaaatttcctcacctcccaattctgtgtaa

DBGET integrated database retrieval system