KEGG   Homo sapiens (human): 9321Help
Entry
9321              CDS       T01001                                 

Gene name
TRIP11, ACG1A, CEV14, GMAP-210, GMAP210, ODCD, TRIP-11, TRIP230
Definition
(RefSeq) thyroid hormone receptor interactor 11
  KO
K23368  thyroid receptor-interacting protein 11
Organism
hsa  Homo sapiens (human)
Disease
H00678  Achondrogenesis type IA
H02349  Odontochondrodysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9321 (TRIP11)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    9321 (TRIP11)
  Retrieval pathways
    9321 (TRIP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4407
Motif
Other DBs
NCBI-GeneID: 9321
NCBI-ProteinID: NP_004230
OMIM: 604505
HGNC: 12305
Ensembl: ENSG00000100815
Vega: OTTHUMG00000171128
Pharos: Q15643(Tbio)
UniProt: Q15643
Position
14q32.12
AA seq 1979 aa AA seqDB search
MSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAI
HAILRSENERLKKLCTDLEEKHEASEIQIKQQSTSYRNQLQQKEVEISHLKARQIALQDQ
LLKLQSAAQSVPSGAGVPATTASSSFAYGISHHPSAFHDDDMDFGDIISSQQEINRLSNE
VSRLESEVGHWRHIAQTSKAQGTDNSDQSEICKLQNIIKELKQNRSQEIDDHQHEMSVLQ
NAHQQKLTEISRRHREELSDYEERIEELENLLQQGGSGVIETDLSKIYEMQKTIQVLQIE
KVESTKKMEQLEDKIKDINKKLSSAENDRDILRREQEQLNVEKRQIMEECENLKLECSKL
QPSAVKQSDTMTEKERILAQSASVEEVFRLQQALSDAENEIMRLSSLNQDNSLAEDNLKL
KMRIEVLEKEKSLLSQEKEELQMSLLKLNNEYEVIKSTATRDISLDSELHDLRLNLEAKE
QELNQSISEKETLIAEIEELDRQNQEATKHMILIKDQLSKQQNEGDSIISKLKQDLNDEK
KRVHQLEDDKMDITKELDVQKEKLIQSEVALNDLHLTKQKLEDKVENLVDQLNKSQESNV
SIQKENLELKEHIRQNEEELSRIRNELMQSLNQDSNSNFKDTLLKEREAEVRNLKQNLSE
LEQLNENLKKVAFDVKMENEKLVLACEDVRHQLEECLAGNNQLSLEKNTIVETLKMEKGE
IEAELCWAKKRLLEEANKYEKTIEELSNARNLNTSALQLEHEHLIKLNQKKDMEIAELKK
NIEQMDTDHKETKDVLSSSLEEQKQLTQLINKKEIFIEKLKERSSKLQEELDKYSQALRK
NEILRQTIEEKDRSLGSMKEENNHLQEELERLREEQSRTAPVADPKTLDSVTELASEVSQ
LNTIKEHLEEEIKHHQKIIEDQNQSKMQLLQSLQEQKKEMDEFRYQHEQMNATHTQLFLE
KDEEIKSLQKTIEQIKTQLHEERQDIQTDNSDIFQETKVQSLNIENGSEKHDLSKAETER
LVKGIKERELEIKLLNEKNISLTKQIDQLSKDEVGKLTQIIQQKDLEIQALHARISSTSH
TQDVVYLQQQLQAYAMEREKVFAVLNEKTRENSHLKTEYHKMMDIVAAKEAALIKLQDEN
KKLSTRFESSGQDMFRETIQNLSRIIREKDIEIDALSQKCQTLLAVLQTSSTGNEAGGVN
SNQFEELLQERDKLKQQVKKMEEWKQQVMTTVQNMQHESAQLQEELHQLQAQVLVDSDNN
SKLQVDYTGLIQSYEQNETKLKNFGQELAQVQHSIGQLCNTKDLLLGKLDIISPQLSSAS
LLTPQSAECLRASKSEVLSESSELLQQELEELRKSLQEKDATIRTLQENNHRLSDSIAAT
SELERKEHEQTDSEIKQLKEKQDVLQKLLKEKDLLIKAKSDQLLSSNENFTNKVNENELL
RQAVTNLKERILILEMDIGKLKGENEKIVETYRGKETEYQALQETNMKFSMMLREKEFEC
HSMKEKALAFEQLLKEKEQGKTGELNQLLNAVKSMQEKTVVFQQERDQVMLALKQKQMEN
TALQNEVQRLRDKEFRSNQELERLRNHLLESEDSYTREALAAEDREAKLRKKVTVLEEKL
VSSSNAMENASHQASVQVESLQEQLNVVSKQRDETALQLSVSQEQVKQYALSLANLQMVL
EHFQQEEKAMYSAELEKQKQLIAEWKKNAENLEGKVISLQECLDEANAALDSASRLTEQL
DVKEEQIEELKRQNELRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRH
EVLRLMGSILGVRREEMEQLFHDDQGGVTRWMTGWLGGGSKSVPNTPLRPNQQSVVNSSF
SELFVKFLETESHPSIPPPKLSVHDMKPLDSPGRRKRDTNAPESFKDTAESRSGRRTDVN
PFLAPRSAAVPLINPAGLGPGGPGHLLLKPISDVLPTFTPLPALPDNSAGVVLKDLLKQ
NT seq 5940 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctggcttgggggcctcggctccggattgggccagtctctgggtcaagtcggg
ggcagcctggcttccctcactggccagatatcaaactttacaaaggatatgctgatggag
ggcacggaggaagtggaagcagaattacctgattctaggacaaaggaaattgaagccatt
catgcaatcttgagatcagagaatgaaaggcttaagaaactttgtactgatctagaagag
aaacatgaagcatcagagattcaaataaagcagcaatctacaagttaccgaaatcaactt
caacaaaaagaggtagaaatcagccatcttaaagccagacagattgcactccaggatcag
ttgctgaaactgcagtcagctgctcagtcagtaccttcaggagctggtgtaccagcaacc
actgcatcatcttcattcgcttatgggattagtcatcatccttcagctttccatgacgat
gacatggactttggtgatataatttcatcccaacaagaaataaaccgactctcaaatgaa
gtttcaagacttgagtctgaagttggccattggaggcatattgctcagacttccaaagca
caaggaacagataactctgatcaaagtgaaatatgtaaactacaaaatatcattaaggaa
ctaaaacagaaccgaagtcaggaaattgatgaccatcaacatgaaatgtcagtactgcag
aatgcacaccaacagaaattgacagaaataagtcgacgacatcgagaagaattaagtgac
tatgaagaacgaattgaagaacttgaaaatctgttacaacaaggtggctctggagttata
gaaactgatctctctaaaatctatgagatgcaaaaaactattcaagttctacaaatagaa
aaagtggagtctaccaaaaaaatggaacaacttgaggataaaataaaagatataaataaa
aaattatcttctgcagaaaatgacagagatattttgaggagagaacaagaacagctaaat
gtggaaaagagacaaataatggaagaatgtgaaaacttgaaattggaatgtagtaaattg
cagccttctgctgtgaagcaaagtgatactatgacagaaaaggaaagaattcttgcccag
agtgcatcagtggaagaagtgttcagactacaacaagcactgtctgatgccgaaaatgaa
ataatgagattgagtagtttaaaccaggataacagtcttgctgaagacaatctgaaactt
aaaatgcgtatcgaagttttagaaaaagagaagtcattactgagtcaagaaaaggaagaa
cttcagatgtcacttttaaaattgaacaatgaatatgaagtaattaaaagtacagctaca
agagacataagtttggattcagaattacatgacttaagacttaatttggaggcaaaggaa
caagaactcaatcagagtattagtgaaaaggaaacactgatagctgagatagaagaattg
gacagacagaatcaagaagctacaaagcacatgattttgataaaagatcagctatcaaaa
caacaaaatgaaggagatagcatcatcagtaaactgaaacaagatctaaatgatgaaaaa
aagagagttcatcaacttgaagatgataaaatggacattactaaagagttagatgtacag
aaagaaaagctaattcaaagtgaagtggccctaaatgatttacatttaaccaagcagaaa
cttgaggacaaagtagaaaatttagtagatcagctaaataaatcacaagaaagtaatgta
agcatccagaaggagaatttagaacttaaggagcatattagacaaaatgaggaggagctt
tctagaataaggaatgagttaatgcagtctctaaatcaagactctaatagtaattttaag
gataccttacttaaagaaagagaagctgaagttagaaacttaaagcaaaatctttcagaa
ttagaacagctcaatgaaaatttaaagaaagttgcttttgatgtcaaaatggaaaatgaa
aagttagttttagcatgtgaagatgtgaggcatcagttagaagaatgtcttgctggtaac
aatcagctttctctggaaaaaaacactattgtggagactctaaaaatggaaaaaggagag
atagaggcagaattgtgttgggctaaaaagaggctgttggaagaagcaaacaagtatgag
aaaaccattgaagaactgtcaaatgcacgtaatttgaatacctctgccttacagctggaa
catgagcatttaattaaactcaatcaaaagaaagacatggaaatagcagaactcaaaaag
aatattgaacaaatggatactgaccataaagaaactaaggacgttttgtcatctagttta
gaagagcagaagcagttgacacaacttataaacaagaaagaaatttttattgaaaagctt
aaagaaagaagttcaaagctgcaggaggaattggataaatattctcaggccttaagaaaa
aatgaaattttaagacagaccatagaggaaaaagaccgaagtcttggatccatgaaagag
gaaaataatcatctgcaagaagaattggaacgactcagggaagagcagagtcgaaccgca
cctgtggctgaccctaaaacccttgatagtgttactgaactagcatctgaggtatctcaa
ctgaacacgatcaaggaacatcttgaagaggaaattaaacatcatcaaaagataattgaa
gatcaaaaccagagtaagatgcaactacttcagtctttacaagagcaaaagaaggaaatg
gatgagtttagataccagcatgagcaaatgaacgccacacacacccagctctttttagag
aaggatgaggaaattaagagtttgcaaaaaacaattgaacaaatcaaaacccagttgcat
gaagaaagacaggacattcaaacagataactctgatatttttcaagaaacaaaagttcag
agccttaatatagaaaatggaagtgaaaagcatgatttatctaaagctgaaacggaaaga
ttagtgaaaggaataaaagagcgagaactggagattaaacttctaaatgaaaagaatata
tctttaactaaacagattgatcagttgtccaaagatgaagttggtaaactaactcagatt
attcagcagaaagatttggagatacaagctcttcatgctagaatttcttcaacttcccat
actcaagatgttgtttaccttcaacagcaactgcaggcttatgctatggaaagagaaaag
gtatttgctgttttgaatgagaagactagggaaaatagccatctaaaaacagaatatcac
aaaatgatggatattgttgctgccaaggaagcagctcttatcaaactgcaagatgaaaat
aaaaaattgtccactagatttgaaagtagtggccaagatatgtttagagaaactattcag
aatttatcacgtatcattcgagaaaaagacatcgaaatagatgcactaagtcagaaatgt
cagactttattggcagttttacaaacatccagcactggtaatgaggctggaggtgttaat
agtaatcaatttgaggagcttctacaggaacgtgacaagttaaaacagcaagtaaagaaa
atggaagagtggaagcagcaggtgatgaccacagtacaaaatatgcaacacgagtcagcc
cagcttcaggaagagcttcaccaacttcaagcacaggttttggttgacagtgataataat
tctaaattacaagtggactatactggcctgatccaaagttatgagcagaatgaaaccaaa
ctcaaaaattttgggcaggaattagcacaagttcagcacagcattgggcagctttgcaat
accaaggatcttcttttaggaaaacttgatattatttcaccccagctgtcttctgcatca
ttgcttactccccagtctgcagagtgtcttagagcaagtaagtctgaagtattgagtgaa
tcttctgaattgcttcagcaagagttagaagagctaagaaaatcactacaggaaaaagat
gcaacaattagaactctccaggaaaataaccacagattgtctgattcgattgctgccacc
tcagagctagaaagaaaagaacacgaacaaaccgattcagaaatcaagcagctaaaggag
aaacaagatgttttgcaaaagttacttaaggaaaaagacctcttaatcaaagccaaaagt
gatcaactactttcttccaatgaaaatttcactaacaaagtaaatgaaaacgaacttttg
aggcaggcagtaacaaacctgaaggagagaatattaattctagagatggacattggcaaa
ctaaaaggagaaaatgaaaaaatagtggaaacatacaggggaaaggaaacagaatatcaa
gcgttacaagagactaacatgaagttttctatgatgctgcgagaaaaagagtttgagtgc
cactcaatgaaggagaaggctcttgcttttgaacagctattgaaagagaaagaacagggc
aagactggagagttaaatcagcttttaaatgcagttaaatcaatgcaggagaagacagtt
gtgtttcaacaggagagagaccaagtcatgttggccctgaaacaaaaacaaatggaaaat
actgccctacagaatgaggttcaacgtttacgtgacaaagaatttcgttcaaaccaagag
ctagagagattgcgtaatcatcttttagaatcagaagattcttatacccgtgaagctttg
gctgcagaagatagagaggctaaactaagaaagaaagtcacagtattggaggaaaagcta
gtttcatcctctaatgcaatggaaaatgcaagccatcaagccagtgtgcaggtagagtca
ttgcaagaacagttgaatgtagtttccaagcaaagggatgaaactgcgctgcagctttct
gtctctcaggaacaagtaaagcagtatgctctgtcactggccaacctgcagatggtacta
gagcatttccaacaagaggaaaaagctatgtattctgctgaactcgaaaagcaaaaacag
cttatagctgaatggaagaaaaacgcagaaaatctggaaggaaaagtgatatcattacag
gaatgtttggatgaagcaaatgctgcattggattcagcatcaagacttacagaacagtta
gatgtaaaagaagaacaaattgaagaacttaaaagacaaaatgagctccgacaagaaatg
ctggatgatgtacaaaagaaattgatgagcttagcaaacagctcagaaggaaaagtagac
aaagtcctaatgagaaacctcttcattggtcatttccacacaccgaaaaatcagcgtcat
gaagtgttacggttaatggggagcatcctgggcgtcagaagggaggagatggagcagttg
tttcatgacgatcagggcggtgttaccaggtggatgactgggtggcttggaggaggatca
aaaagtgttcccaacacacctttgagaccaaatcagcaatctgtggttaatagttctttt
tcagaactttttgttaaatttctagaaacagaatctcatccatccattccaccaccaaag
ctttctgttcatgatatgaaacctctggattcaccaggaagaagaaaaagagatacaaat
gcaccagaaagttttaaagatacagcagaatccaggtctggtagaagaacagatgtaaat
ccgtttttggctcctcgctcggcagctgtacctcttattaacccagctggacttggacct
ggtgggcccgggcatcttcttctgaaacccatctcagatgttttgcccacatttacacct
ttgccagcgttacctgacaacagtgctggggttgtgctgaaagaccttttaaagcaatag

DBGET integrated database retrieval system