KEGG   Homo sapiens (human): 9333
Entry
9333              CDS       T01001                                 

Gene name
TGM5, PSS2, TGASE5, TGASEX, TGM6, TGMX, TGX
Definition
(RefSeq) transglutaminase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Disease
H00737  Peeling skin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    9333 (TGM5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     9333 (TGM5)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Other DBs
NCBI-GeneID: 9333
NCBI-ProteinID: NP_963925
OMIM: 603805
HGNC: 11781
Ensembl: ENSG00000104055
Vega: OTTHUMG00000176488
Pharos: O43548(Tbio)
UniProt: O43548 B4DPS8
Position
15q15.2
AA seq 720 aa
MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFV
VETGPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIH
IDSFQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCP
WNYGQFEDKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPAYGGWQVLD
ATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQP
SRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLK
VNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALG
EEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGS
GLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcccaagggctagaagtggccctcacagacctccagagctccagaaataatgtgcgg
caccacacggaggagatcactgtggaccacctgcttgttcgccggggccaggccttcaac
ctcaccctgtacttcaggaaccggagcttccagccaggcctggacaacatcatcttcgtg
gttgaaactggaccgctgccagacctggccttggggactcgggctgtgttcagcctggca
cgccatcacagccccagcccctggattgcctggctggagaccaatggggccacctccaca
gaggtgagcttgtgcgctcctcccacggcggccgtgggtcggtacctcttgaaaatccac
atcgactccttccaggggtctgtgacggcctaccagctaggggagttcatcctgcttttc
aatccctggtgcccagaggatgctgtctacttggacagtgaaccccagaggcaggagtat
gtcatgaatgattatggcttcatctaccaaggcagcaagaactggatccgcccatgtccc
tggaactatggacagtttgaagacaaaatcatagacatctgcctgaagctgctagacaag
agcctgcacttccagactgacccagccacagactgtgctctgcggggaagccccgtctac
gtcagcagagtggtgtgtgccatgatcaacagcaatgatgataatggggtgctcaatgga
aactggagtgagaattacacagacggcgccaaccctgcggagtggacgggcagcgtggcc
atcctgaagcagtggaacgccacaggctgccagcccgtgcgctacgggcaatgctgggtc
tttgctgccgtcatgtgcacagtgatgaggtgtctggggatccctacccgtgtgatcacc
aacttcgactctggccacgatacagatggaaacctgatcatagatgagtattatgacaac
acaggcaggattttggggaataagaagaaggatactatctggaacttccatgtctggaat
gagtgctggatggcccggaaggatctgccccctgcatatggaggctggcaggtgctggac
gccacacctcaggagatgagcaacggcgtctactgctgtggccctgcctctgtcagagcc
atcaaagaaggagaagtggacctgaactatgacacgccctttgtgttttcgatggtgaat
gctgactgcatgtcctggctcgtccagggagggaaggagcagaagcttcaccaggacacg
agttctgttggcaattttatcagcacaaagagcatccagagtgacgagcgggatgacatc
acagagaactacaagtatgaagaaggatccctccaggagaggcaggtgtttctgaaggct
ctgcagaagctgaaggctagaagcttccatggctcccaaagaggagcagagttgcaacct
tccaggcccacatcactgagccaggacagccctcggagcctgcatacaccttcccttcga
cccagtgatgtggtgcaagtctccctgaaattcaagctgctcgacccgcccaacatgggc
caggatatatgctttgtcctgctggccctcaacatgtcctcccagttcaaggacctcaaa
gtgaacctgagtgcccagtctctgctgcacgatggcagccccctgtccccattctggcag
gacacagcgttcatcacactctctcctaaagaagcaaagacctacccctgcaaaatctcc
tattcccagtacagccagtacctgtcaacagacaagctgatccgcatcagtgccctgggt
gaagagaaaagcagtcctgagaaaatcctggtgaacaagatcatcaccttatcttatcca
agcatcacgattaatgttctaggagcagccgttgtgaaccagccactctccatacaggtg
atattttcaaaccccctctcggagcaggttgaggactgtgtgctgactgtggaaggaagt
ggcctcttcaagaaacagcagaaagtcttccttggagtcctcaaaccccaacaccaagca
agcatcattctggagaccgtccccttcaagagtggacaaaggcagatccaagctaatatg
agaagcaacaagtttaaggacattaagggttacaggaatgtttatgtagactttgcatta
taa

DBGET integrated database retrieval system