KEGG   Homo sapiens (human): 93349Help
Entry
93349             CDS       T01001                                 

Gene name
SP140L
Definition
(RefSeq) SP140 nuclear body protein like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: HSR SAND Bromodomain PHD
Motif
Other DBs
NCBI-GeneID: 93349
NCBI-ProteinID: NP_612411
OMIM: 617747
HGNC: 25105
Ensembl: ENSG00000185404
Vega: OTTHUMG00000153730
Pharos: Q9H930(Tdark)
UniProt: Q9H930
Position
2q37.1
AA seq 580 aa AA seqDB search
MAGGGSDLSTRGLNGGVSQVANEMNHLPAHSQSLQRLFTEDQDVDEGLVYDTVFKHFKRH
KLEISNAIKKTFPFLEGLRDRELITNKMFEDSEDSCRNLVPVQRVVYNVLSELEKTFNLS
VLEALFSEVNMQEYPDLIHIYKSFKNAIQDKLSFQESDRKEREERPDIKLSLKQGEVPES
PEARKESDQACGKMDTVDIANNSTLGKPKRKRRKKKGHGWSRMGTRTQKNNQQNDNSKAD
GQLVSSEKKANMNLKDLSKIRGRKRGKPGTHFTQSDRAPQKRVRSRASRKHKDETVDFQA
PLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIKGGYARSKNWRLSVRCG
GWPLRRLMEEGSLPNPPRIYYRNKKRILKSQNNSSVDPCMRNLDECEVCRDGGELFCCDT
CSRVFHEDCHIPPVESEKTPWNCIFCRMKESPGSQQCCQESEVLERQMCPEEQLKCEFLL
LKVYCCSESSFFAKIPYYYYIREACQGLKEPMWLDKIKKRLNEHGYPQVEGFVQDMRLIF
QNHRASYKYKDFGQMGLRLEAEFEKDFKEVFAIQETNGNS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtgggggcagcgacctgagcaccagggggctgaacggaggtgtttcacaagta
gcaaatgagatgaaccatcttcctgcacacagccaaagtctgcaaaggctgttcacggaa
gaccaggatgtagatgagggacttgtctatgacactgtattcaagcacttcaaaagacat
aagctggagatatcaaatgcaataaaaaagacatttccattccttgagggcctccgcgat
cgggaactcatcacaaataaaatgtttgaagattctgaagattcttgtagaaacctggtc
cctgtacaaagagtggtgtacaatgttctcagtgaactggagaagacatttaacctgtca
gttttggaagcactgttcagcgaggtcaacatgcaggaataccccgatttaattcacatt
tataaaagcttcaaaaatgcaatccaagacaaattgtctttccaagaaagtgatcgaaaa
gaaagggaagagaggcctgacatcaaactaagtcttaaacaaggagaagtgccagaaagc
ccggaagcaaggaaggaaagtgaccaagcatgtggcaaaatggatactgtggatattgca
aacaactctactttgggaaaacccaagaggaaaagaagaaaaaagaaggggcatggctgg
agcagaatgggaacgagaacgcagaaaaacaaccaacaaaatgataacagcaaagccgat
ggccagctggtctcgagtgaaaagaaggcgaacatgaatctgaaagacctttccaagatt
agggggagaaagagaggcaaacctggaacccactttactcagagtgacagagctccacag
aaaagagtccgatcaagagcttcaagaaagcacaaagatgaaactgtggattttcaggct
cctttacttccagtgacctgtggtggggtgaagggaattttacataaggagaaattggaa
caaggaaccttggcaaagtgtatacagactgaggatggaaaatggttcacccccatggaa
tttgaaatcaaaggaggctacgcaagatcaaagaactggaggctgagtgtgcgctgtggc
gggtggcccctacgacggctgatggaggaaggatctctacctaatcctccaagaatatat
tacaggaacaaaaagagaatactgaagtctcaaaacaatagctcagttgacccttgtatg
agaaacttggatgagtgtgaggtgtgccgggacggaggggagctgttctgttgcgacact
tgttcaagagtcttccatgaggactgccacatcccacctgtggaaagtgagaagaccccg
tggaattgcatcttctgcaggatgaaggagtctccgggaagccaacagtgttgtcaggaa
tctgaggtcctggagaggcagatgtgtcctgaggaacagttgaaatgtgagttcctcctc
ttgaaagtctattgctgttctgagagctccttttttgccaagattccatactattattat
attagagaggcgtgtcaaggcctgaaggagcccatgtggttggataaaatcaagaaaagg
ctgaatgagcacggttacccccaagtggaggggtttgtacaagacatgcgcctcatcttc
cagaaccacagggcctcttacaagtataaggattttggccaaatgggacttagactggag
gctgaatttgagaaggatttcaaggaagtgtttgctattcaggaaacaaatgggaacagt
tga

DBGET integrated database retrieval system