KEGG   Homo sapiens (human): 93377
Entry
93377             CDS       T01001                                 
Symbol
OPALIN, HTMP10, TMEM10, TMP10
Name
(RefSeq) oligodendrocytic myelin paranodal and inner loop protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 93377
NCBI-ProteinID: NP_149984
OMIM: 617200
HGNC: 20707
Ensembl: ENSG00000197430
Pharos: Q96PE5(Tdark)
UniProt: Q96PE5
Position
10:complement(96343221..96359002)
AA seq 141 aa
MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI
EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR
PTIEMERRRGLWWLVPRLSLE
NT seq 426 nt   +upstreamnt  +downstreamnt
atgagtttttcactgaacttcaccctgccggcgaacacaacgtcctctcctgtcacaggt
gggaaagaaacggactgtgggccctctcttggattagcggcgggcataccattgctggtg
gccacagccctgctggtggctttactatttactttgattcaccgaagaagaagcagcatt
gaggccatggaggaaagtgacagaccatgtgaaatttcagaaattgatgacaatcccaag
atatctgagaatcctaggagatcacccacacatgagaagaatacgatgggagcacaagag
gcccacatatatgtgaagactgtagcaggaagcgaggaacctgtgcatgaccgttaccgt
cctactatagaaatggaaagaaggaggggattgtggtggcttgtgcccagactgagcctg
gaatga

DBGET integrated database retrieval system