KEGG   Homo sapiens (human): 9340Help
Entry
9340              CDS       T01001                                 

Gene name
GLP2R
Definition
(RefSeq) glucagon like peptide 2 receptor
  KO
K04582  glucagon-like peptide 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Teduglutide: D06053
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9340 (GLP2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9340 (GLP2R)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    9340 (GLP2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM SUR7
Motif
Other DBs
NCBI-GeneID: 9340
NCBI-ProteinID: NP_004237
OMIM: 603659
HGNC: 4325
Ensembl: ENSG00000065325
Vega: OTTHUMG00000130269
Pharos: O95838(Tclin)
UniProt: O95838 B2RAN4
Position
17p13.1
AA seq 553 aa AA seqDB search
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS
IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS
YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL
MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS
KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW
PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK
ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK
LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM
ANTMEEILEESEI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggatcgagcagggcagggcctgggagaggaagcgcgggactcctgcctggc
gtccacgagctgcccatgggcatccctgccccctgggggaccagtcctctctccttccac
aggaagtgctctctctgggcccctgggaggcccttcctcactctggtcctgctggtttcc
atcaagcaagttacaggatccctccttgaggaaacgactcggaagtgggctcagtacaaa
caggcatgtctgagagacttactcaaggaaccttctggcatattttgtaacgggacattt
gatcagtacgtgtgttggcctcattcttctcctggaaatgtctctgtaccctgcccttca
tacttaccttggtggagtgaagagagctcaggaagggcctacagacactgcttggctcag
gggacttggcagacgatagagaacgccacggatatttggcaggatgactccgaatgctcc
gagaaccacagcttcaagcaaaacgtggatcgttatgccttgctgtcaaccttgcagctg
atgtacaccgtgggatactccttctctcttatctccctcttcctggctctcaccctcctc
ttgtttcttcgaaaactccactgcacgcgcaactacatccacatgaacttgtttgcttct
ttcatcctgagaaccctggctgtactggtgaaggacgtcgtcttctacaactcttactcc
aagaggcctgacaatgagaatgggtggatgtcctacctgtcagagatgtccacctcctgc
cgctcagtccaggttctcttgcattactttgtgggtgccaattacttatggctgctggtt
gaaggcctctacctccacacgctgctggagcccacagtgcttcctgagaggcggctgtgg
cccagatacctgctgttgggttgggccttccctgtgctatttgttgtaccctggggtttc
gcccgtgcacacctggagaacacagggtgctggacaacaaatgggaataagaaaatctgg
tggatcatccgaggacccatgatgctctgtgtaacagtcaatttcttcatcttcctgaaa
attctcaagcttctcatttctaagctcaaagctcatcaaatgtgcttcagagattataaa
tacagattggcaaaatcaacactggtcctcattcctttattgggcgttcatgagatcctc
ttctctttcatcactgatgatcaagttgaaggatttgcaaaacttatacgacttttcatt
cagttgacactgagctcctttcatgggttcctggtggccttgcagtatggttttgccaat
ggagaggtgaaggctgagctgcggaaatactgggtccgcttcttgctagcccgccactca
ggctgcagagcctgtgtcctggggaaggacttccggttcctaggaaaatgtcccaagaag
ctctcggaaggagatggcgctgagaagcttcggaagctgcagccctcacttaacagtggg
cggctcctacatctagccatgcgaggtcttggggagctgggcgcccagccccaacaggac
catgcacgctggccccggggcagcagcctgtccgagtgcagtgagggggatgtcaccatg
gccaacaccatggaggagattctggaagagagtgagatctag

DBGET integrated database retrieval system