KEGG   Homo sapiens (human): 9341
Entry
9341              CDS       T01001                                 

Gene name
VAMP3, CEB
Definition
(RefSeq) vesicle associated membrane protein 3
  KO
K13505  vesicle-associated membrane protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9341 (VAMP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9341 (VAMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9341 (VAMP3)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    9341 (VAMP3)
SSDB
Motif
Pfam: Synaptobrevin Env-gp36 MCU Shisa
Other DBs
NCBI-GeneID: 9341
NCBI-ProteinID: NP_004772
OMIM: 603657
HGNC: 12644
Ensembl: ENSG00000049245
Vega: OTTHUMG00000001225
Pharos: Q15836(Tbio)
UniProt: Q15836 Q6FGG2
Position
1p36.23
AA seq 100 aa
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF
ETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
NT seq 303 nt   +upstreamnt  +downstreamnt
atgtctacaggtccaactgctgccactggcagtaatcgaagacttcagcagacacaaaat
caagtagatgaggtggtggacataatgcgagttaacgtggacaaggttctggaaagagac
cagaagctctctgagttagacgaccgtgcagacgcactgcaggcaggcgcttctcaattt
gaaacgagcgcagccaagttgaagaggaaatattggtggaagaattgcaagatgtgggca
atcgggattactgttctggttatcttcatcatcatcatcatcgtgtgggttgtctcttca
tga

DBGET integrated database retrieval system