KEGG   Homo sapiens (human): 9342Help
Entry
9342              CDS       T01001                                 

Gene name
SNAP29, CEDNIK, SNAP-29
Definition
(RefSeq) synaptosome associated protein 29
  KO
K08509  synaptosomal-associated protein 29
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04140  Autophagy - animal
Disease
H00799  CEDNIK syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9342 (SNAP29)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9342 (SNAP29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9342 (SNAP29)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    9342 (SNAP29)
 SNARE
  SNAP-25 (Qb,c)
   SNAP-29
    9342 (SNAP29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-SNARE_C KxDL
Motif
Other DBs
NCBI-GeneID: 9342
NCBI-ProteinID: NP_004773
OMIM: 604202
HGNC: 11133
Ensembl: ENSG00000099940
Vega: OTTHUMG00000150765
Pharos: O95721(Tbio)
UniProt: O95721
Structure
PDB: 

Position
22q11.21
AA seq 258 aa AA seqDB search
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGA
GSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTK
VDKLDVNIKSTERKVRQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttaccctaaaagctacaatccgttcgacgacgacggggaggacgaaggcgcc
cggccggccccttggagggacgcccgagacctccccgacgggcccgacgcgcccgcggac
aggcagcagtacttgcggcaggaggtcctccgcagggctgaggccacggccgccagcacc
agcaggtccctggccctcatgtacgagtccgagaaggttggggtcgcctcttccgaggag
ctcgcccgtcagcgaggagtcctggagcgcacagagaagatggtggacaagatggaccaa
gatttgaagatcagccagaaacacatcaatagcattaagagcgtgtttggggggctggtc
aattacttcaaatccaaaccagtagagaccccacctgaacagaatggcaccctcacctcc
cagcccaacaacagattgaaagaagctataagtacaagtaaagaacaggaagcaaagtac
caggccagccacccaaaccttagaaagctggatgatacagaccctgtccccagaggggct
ggttctgccatgagtactgatgcttacccaaagaacccacaccttcgagcctatcaccag
aagatcgacagcaacctagatgagctgtccatgggactgggtcgtctgaaggacatagcc
ctggggatgcagacagaaattgaggagcaagatgacattcttgaccggctgacaaccaaa
gtggacaagttagatgtcaacataaaaagcacagaaagaaaagttcgacaactctga

DBGET integrated database retrieval system