KEGG   Homo sapiens (human): 93436
Entry
93436             CDS       T01001                                 
Symbol
ARMC6, R30923_1
Name
(RefSeq) armadillo repeat containing 6
  KO
K24166  armadillo repeat-containing protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    93436 (ARMC6)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Armadillo repeat domain-containing proteins
   93436 (ARMC6)
SSDB
Motif
Pfam: Arm CTNNBL Mis14 Drf_GBD
Other DBs
NCBI-GeneID: 93436
NCBI-ProteinID: NP_001186125
HGNC: 25049
Ensembl: ENSG00000105676
Pharos: Q6NXE6(Tdark)
UniProt: Q6NXE6
Position
19:19033603..19058176
AA seq 501 aa
MSERCCSRYSSGASIGCTPTSTQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVE
QFESQGVDLSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQ
CKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQL
LVATLTQNADEADLTCSGIRCVRHACLKHEQNRQDLVKAGVLPLLTGAITHHGHHTDVVR
EACWALRVMTFDDDIRVPFGHAHNHAKMIVQENKGLKVLIEATKAFLDNPGILSELCGTL
SRLAIRNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGVQELVKQVLSTLRAIAGNDDV
KDAIVRAGGTESIVAAMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVEGGGAVAALQA
MKAHPQKAGVQKQACMLIRNLVAHGQAFSKPILDLGAEALIMQARSAHRDCEDVAKAALR
DLGCHVELRELWTGQRGNLAP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagtgaacgatgttgctctagatacagctcaggagcatctatcggctgcacgccaaca
tcaacacaggcgaagatggtctccaagcgcattgcccaggagacctttgatgcagctgtg
cgcgagaacatcgaggagtttgcgatggggccagaggaggcagtgaaagaggccgtggag
cagtttgaatcgcaaggggttgatctgagcaacattgtaaagacggcacctaaagtctct
gcagacggatcccaggagcccacacatgacatcctgcagatgctcagtgacctccaggag
tctgtggccagctctcgcccccaggaggtgtcagcatacctcacccgcttctgcgaccag
tgcaaacaggacaaggcctgccgcttcctcgcggcccagaagggggcctaccccatcatc
ttcactgcctggaagctggccactgcaggtgaccagggccttctgctccagtccctcaat
gccctgtcggtgctgactgatggacagccagacctcctggatgcccagggcctgcagctc
ctagtggccacgctgacccagaatgctgatgaggctgacctgacctgctctgggatccgc
tgtgtgcgtcacgcttgcctgaaacatgaacagaatcggcaagacctggtgaaagctggc
gtgctgcctctgctgactggtgccatcacccatcatggccaccacactgacgtggtcagg
gaagcctgctgggccctgcgtgtcatgaccttcgatgacgacatccgtgtgccctttggc
catgcccacaaccatgccaagatgattgtgcaggagaacaaaggcttgaaggtgctcatc
gaagccaccaaagcgttcctggataaccctggcatcctgagcgagctctgtggaaccctg
tcccgcctggccattcgcaacgagttctgccaggaggtcgtcgacctcgggggcctgagc
attctggtgtccctgctagccgactgcaatgaccaccagatgagggaccagagcggcgtt
caggagctcgtgaagcaagtgctgagcaccctgcgagccatcgcaggcaacgacgacgtg
aaagatgctattgtccgtgctggtgggacggagtccatcgtggctgctatgacccagcat
ctgaccagcccccaggtgtgtgagcagagctgcgcggccctgtgcttcctggccctgcgt
aagcccgacaacagccgcatcatcgtggagggtggcggggctgtggcagcactgcaggcc
atgaaggcacacccgcagaaggccggcgtgcagaaacaggcttgcatgctgatccgaaac
ctggtggcccacggccaggccttctcgaagcccatcctggacctgggggctgaggcactc
atcatgcaggcccgatctgcccaccgtgactgtgaggacgtggccaaggccgccctgcgg
gacctgggttgtcatgtcgagctccgagagctgtggacaggccagaggggcaacctggcg
ccatga

DBGET integrated database retrieval system