KEGG   Homo sapiens (human): 93587
Entry
93587             CDS       T01001                                 
Symbol
TRMT10A, HEL-S-88, MSSGM, MSSGM1, RG9MTD2, TRM10
Name
(RefSeq) tRNA methyltransferase 10A
  KO
K15445  tRNA (guanine9-N1)-methyltransferase [EC:2.1.1.221]
Organism
hsa  Homo sapiens (human)
Disease
H01923  Microcephaly, short stature, and impaired glucose metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    93587 (TRMT10A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.221  tRNA (guanine9-N1)-methyltransferase
     93587 (TRMT10A)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    93587 (TRMT10A)
SSDB
Motif
Pfam: tRNA_m1G_MT
Other DBs
NCBI-GeneID: 93587
NCBI-ProteinID: NP_001128137
OMIM: 616013
HGNC: 28403
Ensembl: ENSG00000145331
Pharos: Q8TBZ6(Tbio)
UniProt: Q8TBZ6 V9HVY8
Structure
Position
4:complement(99546711..99564039)
AA seq 339 aa
MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQREL
RKQKRKEKRKRKKLERQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKK
LHKQIQRCYAENRRALHPVQFYLTSHGGQLKKNMDENDKGWVNWKDIHIKPEHYSELIKK
EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHAQLPLGNFVKM
NSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEG
GSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtcatctgaaatgttgccagcatttattgaaacttctaatgttgacaaaaagcaaggc
ataaatgaagatcaagaggagagccagaagccaagattaggtgaagggtgtgaaccaata
tctaaacgacaaatgaaaaaactaataaaacagaaacaatgggaagagcaacgggaactc
cgcaaacaaaagcgaaaagaaaaacgcaagaggaaaaaattagagcgacaatgtcaaatg
gaaccaaactcagatggacatgacagaaaacgtgttcgaagagatgttgttcatagcacc
cttcgccttattattgactgtagttttgatcacttgatggtattaaaggacattaagaaa
cttcataagcagattcaacgatgttacgcagaaaaccgacgggcactgcatcctgtgcag
ttttacttgacaagccacggaggccagctgaaaaagaacatggatgaaaatgacaaagga
tgggtcaactggaaggatatccatatcaaaccagagcactatagtgaactcataaagaaa
gaagacctgatttaccttacgtcagattcacctaatatactgaaggaattagatgaatca
aaggcctatgtgattggaggattagtagatcacaaccatcacaagggactcacatataaa
caagcgtcagattatggaatcaatcatgcacagctcccacttggaaattttgtgaagatg
aatagtcgaaaagttttggcagttaatcatgtgtttgaaattattctggaatacctggaa
acaagagactggcaagaagcattttttactatcttgccccaacggaaaggagctgttccc
acagacaaagcctgtgaaagtgcttctcatgacaatcagtctgtcaggatggaggaaggt
ggatcggacagtgattccagtgaggaggaatatagcagaaatgaactagattcaccacat
gaagaaaagcaggataaggaaaatcacactgaatctacagtgaactctctgccacactaa

DBGET integrated database retrieval system