KEGG   Homo sapiens (human): 9360Help
Entry
9360              CDS       T01001                                 

Gene name
PPIG, CARS-Cyp, CYP, SCAF10, SRCyp
Definition
(RefSeq) peptidylprolyl isomerase G
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9360 (PPIG)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    9360 (PPIG)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     9360 (PPIG)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   PPlases
    9360 (PPIG)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    9360 (PPIG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase SR-25
Motif
Other DBs
NCBI-GeneID: 9360
NCBI-ProteinID: NP_004783
OMIM: 606093
HGNC: 14650
Ensembl: ENSG00000138398
Vega: OTTHUMG00000132206
Pharos: Q13427(Tbio)
UniProt: Q13427
Structure
PDB: 

Position
2q31.1
AA seq 754 aa AA seqDB search
MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
SKVKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESATEEKSKKRKKKHRKNSRK
HKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
NRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPP
HWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN
EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRN
EEKRMRSRSKGRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDR
RAQSRSRECDITKGKHSYNSRTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRR
RGRSRSRERRTPPGRSRSKDRRRRRRDSRSSEREESQSRNKDKYRNQESKSSHRKENSES
EKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNELKSSMLKNKEDEKIRSSVEK
ENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaggttcaacgtcctcgatgtttttttgacattgccattaacaatcaacct
gctggaagagttgtctttgaattattttctgatgtgtgccccaaaacatgcgagaacttt
cgttgtctttgtacaggtgaaaaggggaccgggaaatcaactcagaaaccattacattat
aagagttgtctctttcacagagttgtcaaggattttatggttcaaggtggtgacttcagt
gaaggaaatggacgaggaggggaatctatctatggaggattttttgaagacgagagtttc
gctgttaaacacaacaaagaatttctcttgtcaatggccaacagagggaaggatacaaat
ggttcacagttcttcataacaacgaaaccaactcctcatttagatgggcatcatgttgtt
tttggacaagtaatctctggtcaagaagttgtaagagagattgaaaaccagaaaacagat
gcagctagcaaaccgtttgcggaggtacggatactcagttgtggagagctgattcccaaa
tctaaagttaagaaagaagaaaagaaaaggcataaatcatcatcatcttcctcctcctca
tctagtgactcagatagctcaagtgattctcagtcctcttctgattcctctgattccgaa
agtgctactgaagagaaatcaaagaaaagaaaaaagaaacatcggaaaaattcccgaaaa
cacaagaaagaaaagaaaaagcgaaagaaaagcaagaagagtgcatctagtgagagtgaa
gctgaaaatcttgaagcacaaccccagtctactgtccgtccagaagagatccctcctata
cctgaaaatagattcctaatgagaaaaagtcctcctaaagctgatgagaaggaaaggaaa
aacagagagagagaaagggaaagagagtgtaatccacctaactcccagcctgcttcatac
cagagacgacttttagttactagatctggcaggaaaattaaaggaagaggaccaaggcgt
tatcgaactccttccagatccagatcaagggatcgtttcagacgtagtgagactcctcca
cattggaggcaagagatgcagagagctcaaagaatgagggtatcaagtggtgaaagatgg
atcaagggggataagagtgagttgaatgaaataaaagaaaatcagagaagtccagttaga
gtaaaagagagaaaaataacagatcacaggaatgtatctgagagtccaaacagaaaaaat
gaaaaggagaagaaagttaaagaccataaatctaacagcaaagagagagacatcagaaga
aattcagaaaaagatgacaagtataaaaacaaagtgaagaaaagggccaaatctaaaagt
aggagtaagagcaaagagaaatcaaagagtaaagaaagagattcaaaacataatagaaat
gaagaaaagaggatgaggtcaaggagtaaaggaagggatcatgaaaatgttaaagaaaaa
gaaaagcagtctgattctaaaggaaaagatcaggaaaggagtagaagtaaagagaagtct
aaacagttagaatcaaagagtaatgagcatgatcacagtaaaagtaaggaaaaggataga
cgcgcacaatccaggagtagagaatgtgatataactaaaggtaaacacagttataatagc
agaacaagagaacgaagcagaagtagggacagaagcagaagagtgcgatcaagaacccat
gacagagatcgcagcagaagcaaggagtaccatagatacagagaacaggaatacaggaga
agaggacggtcacgaagccgagagagaagaacaccaccaggaagatcaagaagtaaagat
aggaggagaaggaggagagactcacggagctcagagagagaagaaagtcaaagcagaaac
aaagacaaatacagaaaccaagagagtaagagctcacacagaaaagaaaattctgagagt
gagaaaagaatgtactctaaaagtcgtgatcataatagctcaaataacagcagggaaaaa
aaggctgatagagatcaaagtcccttctcaaaaataaaacaaagcagtcaggacaatgaa
ttaaagtcctccatgttgaaaaataaggaggatgagaagatcagatcctcagtggaaaaa
gaaaaccaaaaatcaaaaggtcaagaaaatgaccatgtacatgaaaaaaataaaaaattt
gatcatgaatcaagccctggaacagatgaagacaaaagcggatga

DBGET integrated database retrieval system