KEGG   Homo sapiens (human): 93661
Entry
93661             CDS       T01001                                 
Symbol
CAPZA3, CAPPA3, Gsg3, HEL-S-86
Name
(RefSeq) capping actin protein of muscle Z-line subunit alpha 3
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    93661 (CAPZA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    93661 (CAPZA3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    93661 (CAPZA3)
   04147 Exosome [BR:hsa04147]
    93661 (CAPZA3)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Others
   WASH complex
    93661 (CAPZA3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     93661 (CAPZA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   93661 (CAPZA3)
SSDB
Motif
Pfam: F-actin_cap_A HemN_C
Other DBs
NCBI-GeneID: 93661
NCBI-ProteinID: NP_201585
OMIM: 608722
HGNC: 24205
Ensembl: ENSG00000177938
Pharos: Q96KX2(Tdark)
UniProt: Q96KX2 A0A140VKF6
Position
12:18738119..18739188
AA seq 299 aa
MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNEAEYLRVV
LLCALKLYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAV
LEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII
NT seq 900 nt   +upstreamnt  +downstreamnt
atgacacttagcgtgctgagcaggaaggacaaggaaagagtaattcgcagactgttatta
caggcccctccaggggaatttgtaaatgcctttgatgatctctgtctgcttatccgtgat
gaaaaacttatgcaccaccaaggtgagtgtgcaggccaccaacactgccaaaaatattct
gtaccactctgcatcgatggaaatccagtactcttgtctcaccacaatgtaatgggcgac
taccgattttttgaccatcaaagcaaactttctttcaaatatgacctgcttcaaaatcag
ctgaaagacatccaaagtcatggtatcattcagaatgaggcagaatacctgagagttgtt
cttctgtgcgccttaaaactgtatgtgaatgaccactatccaaaaggaaattgcaacatg
ctgagaaaaactgtcaaaagtaaggagtacttgatagcttgcattgaagatcacaactat
gaaacaggagagtgctggaacggactttggaaatctaaatggattttccaagttaaccca
tttctaacccaagtaacgggaagaatatttgtgcaagctcacttcttcaggtgtgtcaac
cttcatattgaaatatccaaggacctgaaagaaagcttggaaatagttaaccaagctcaa
ctggctctaagttttgcaaggcttgtggaagagcaagagaacaaatttcaagctgcagtc
ttggaagaattacaggagttatccaatgaagccctgagaaaaattctacgaagggatctt
ccagtgacccgcactcttattgactggcacaggatactctctgacttgaatctggtgatg
tatcctaaattaggatatgtcatttattcaagaagtgtgttgtgcaactggataatataa

DBGET integrated database retrieval system