KEGG   Homo sapiens (human): 93664
Entry
93664             CDS       T01001                                 
Symbol
CADPS2, CAPS2
Name
(RefSeq) calcium dependent secretion activator 2
  KO
K19933  calcium-dependent secretion activator
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    93664 (CADPS2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    93664 (CADPS2)
SSDB
Motif
Pfam: MUN PH
Other DBs
NCBI-GeneID: 93664
NCBI-ProteinID: NP_060424
OMIM: 609978
HGNC: 16018
Ensembl: ENSG00000081803
Pharos: Q86UW7(Tbio)
UniProt: Q86UW7
Position
7:complement(122318411..122886460)
AA seq 1296 aa
MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPS
PSVLSEGRDEPQRQLDDEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQQLQ
LLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVFKKN
IEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMALSAVSELILSKEQLY
EMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLADKMAKERKFPKFIAKD
MENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGDENEIQLSKSD
VVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFTTTHP
RPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHRMVVPKNSQDSDLKIKLAV
RMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLEG
YTVDYTDPHPGLQGGCMFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAIQ
TQKLNPKGGTLHADAQLSGKDADRFQKHGMDEFISANPCKLDHAFLFRILQRQTLDHRLN
DSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLAELMEHSENGAVIDPTLLHYSFAF
CASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPFGRPEGALKATLS
LLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEETMNQASPARKLEEI
LHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWALFTVDMDTALEAQPQDSWD
SFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQ
PVKNIANSLPNVALPKVPSLPLNLPQIPNISTASWMPSLYESTNGSATSEDLFWKLDALQ
MFVFDLHWPEQEFAHHLEQRLKLMASDMLEACVKRTRTAFELKLQKASKTTDLRIPASVC
TMFNVLVDAKKQSTKLCALDGGQEQQYHSKIDDLIDNSVKEIISLLVSKFVSVLEGVLSK
LSRYDEGTFFSSILSFTVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILREKVNEEMYIE
KLFDQWYSSSMKVICVWLTDRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTY
DTVHRRLTVEEATASVSEGGGLQGITMKDSDEEEEG
NT seq 3891 nt   +upstreamnt  +downstreamnt
atgctggacccgtcttccagcgaagaggagtcggacgaggggctggaagaggaaagccgc
gatgtgctggtggcagccggcagctcgcagcgagctcctccagccccgactcgggaaggg
cggcgggacgcgccggggcgcgcgggcggcggcggcgcggccagatctgtgagcccgagc
ccctctgtgctcagcgaggggcgagacgagccccagcggcagctggacgatgagcaggag
cggaggatccgcctgcagctctacgtcttcgtcgtgaggtgcatcgcgtaccccttcaac
gccaagcagcccaccgacatggcccggaggcagcagaagcttaacaaacaacagttgcag
ttactgaaagaacggttccaggccttcctcaatggggaaacccaaattgtagctgacgaa
gcattttgcaacgcagttcggagttattatgaggtttttctaaagagtgaccgagtggcc
agaatggtacagagtggagggtgttctgctaatgacttcagagaagtatttaagaaaaac
atagaaaaacgtgtgcggagtttgccagaaatagatggcttgagcaaagagacagtgttg
agctcatggatagccaaatatgatgccatttacagaggtgaagaggacttgtgcaaacag
ccaaatagaatggccctaagtgcagtgtctgaacttattctgagcaaggaacaactctat
gaaatgtttcagcagattctgggtattaaaaaactggaacaccagctcctttataatgca
tgtcagctggataacgcagatgaacaagcagcccagatcagaagggaacttgatggccgg
ctgcaattggcagataaaatggcaaaggaaagaaaattccccaaatttatagcaaaagat
atggagaatatgtatatagaagagttgcggtcttcagtgaatttgctaatggccaatttg
gaaagtcttccagtttcgaaaggtggtccggaatttaaattacaaaaattaaaacgttca
cagaactctgcatttttggacataggagatgagaatgagattcagctgtcaaagtccgac
gtggtactgtcattcaccttagagattgtcataatggaagtgcaaggcctgaagtcagtt
gctcccaatcgaattgtttactgtacaatggaagtggaaggagaaaaacttcagacagac
caggccgaagcctcaaggccacaatgggggactcaaggagatttcaccaccacccatcct
cggcctgtggtcaaagtgaaactcttcacagaaagcactggagttctggccctggaagat
aaagaactgggaagggtgatattatacccaacttctaatagctccaaatcagctgaatta
caccgaatggtagttccaaaaaatagccaggattctgacttaaaaatcaaactggcagtg
cgaatggataaaccagcacatatgaagcatagtggatatctgtatgcccttggacagaag
gtttggaaaagatggaaaaaacgttactttgttctagttcaggttagccaatataccttt
gctatgtgcagttatagagaaaagaagtctgaaccacaagaattaatgcagcttgaaggc
tatactgtggattataccgatccccacccaggccttcagggtggttgtatgttctttaat
gctgttaaagaaggagatactgtaatctttgccagtgatgatgaacaggacagaatatta
tgggttcaagccatgtatagggccacaggtcaatcatataaaccagttcctgcaattcaa
acccagaaactgaatcctaaaggaggaactctccatgcagatgctcagctttctggtaaa
gatgcagatcgttttcagaaacatggtatggatgagtttatttctgcaaacccctgcaag
cttgatcatgccttcctttttagaatactccagaggcagactttggatcacagactgaat
gattcctattcttgcttgggatggtttagccctggccaagtctttgtgttagatgagtac
tgtgcccgttatggtgtgagaggctgtcacagacatctctgctaccttgcagaactgatg
gaacattcagaaaatggtgctgtcattgaccctaccctgctccattacagctttgcattc
tgtgcctctcatgtgcacggcaacaggcctgatggaattgggactgtttcagtggaagaa
aaagaaagatttgaggagataaaagagagactctcttcccttttagaaaatcagataagc
catttcagatactgttttccctttggacgacctgaaggtgctctaaaagctacactttca
ttacttgaaagggttttaatgaaagatattgccactcccataccagcagaagaggtgaag
aaagtggtcagaaaatgtctcgagaaagctgccttgatcaattacactagactcacagaa
tatgccaaaatagaagagaccatgaaccaggcatctcctgctagaaagctggaagagatt
cttcatctggcagagctctgcatagaagtcttacagcagaatgaagagcatcatgcagag
ggaagagaggcatttgcctggtggcctgatttattggctgaacatgcagagaaattttgg
gctttatttacagtggatatggacactgcactagaggctcaaccgcaagactcctgggat
agttttcctcttttccaactgcttaataatttcctccgaaatgacacacttttgtgtaat
ggaaaatttcacaaacacttgcaagaaatctttgtacccttggttgtccgctatgtggat
ctcatggagtcttccatcgcccagtcaattcacagaggttttgagcaggagacatggcag
cctgtcaagaatatcgccaacagtcttcccaatgtagctcttccaaaagttccaagtctg
cctcttaatcttccacagattcctaacatttctactgcttcgtggatgccttctttatat
gagtccaccaatggctcagcaacatcagaagaccttttttggaagcttgatgcactgcaa
atgtttgtctttgatctgcactggccagaacaggaatttgcccaccacttagagcaaaga
cttaaactaatggccagtgatatgctagaggcctgtgtcaaaagaacaagaactgcattt
gaactcaagctacaaaaggcaagcaaaacaactgacttgcgcattccagcttccgtttgc
actatgtttaatgtattagtcgatgccaaaaagcaaagcaccaaactctgtgccctggat
ggaggacaagagcaacagtaccattcaaaaatagatgatctgatcgacaacagtgtaaaa
gaaatcatttcactgttagtttcaaagtttgtttcagtgttggaaggcgtgttgtctaag
ctgtcaaggtatgatgaaggcactttcttttcatccattctgtcattcactgtgaaagca
gctgcaaaatatgttgatgttccaaaaccaggaatggatctggcagacacctatattatg
tttgttcggcaaaaccaagatattcttcgagaaaaggtcaatgaggaaatgtatatagaa
aagttatttgatcaatggtacagcagttccatgaaagtcatttgcgtgtggttgactgat
agattagacctccaactccatatttaccagctgaagacgctcatcaagattgtgaagaaa
acctacagggactttcgattgcagggtgtgttggaaggaacactgaacagtaagacttat
gatactgtgcacagacgtttaacagtagaggaggccacagcctctgtttcagaaggagga
ggacttcagggcattactatgaaagacagtgacgaagaagaagaaggctga

DBGET integrated database retrieval system