KEGG   Homo sapiens (human): 9369
Entry
9369              CDS       T01001                                 

Gene name
NRXN3, C14orf60
Definition
(RefSeq) neurexin 3
  KO
K07377  neurexin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    9369 (NRXN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9369 (NRXN3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9369 (NRXN3)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Syndecan Laminin_G_3 CD34_antigen DUF202
Other DBs
NCBI-GeneID: 9369
NCBI-ProteinID: NP_001258949
OMIM: 600567
HGNC: 8010
Ensembl: ENSG00000021645
Vega: OTTHUMG00000171502
Pharos: Q9HDB5(Tbio)
UniProt: Q9HDB5
Position
14q24.3-q31.1
AA seq 637 aa
MHLRIHARRSPPRRPAWTLGIWFLFWGCIVSSVWSSSNVASSSSTSSSPGSHSQHEHHFH
GSKHHSVPISIYRSPVSLRGGHAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTT
VKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTR
NGGNATLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLN
MAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTA
SIQPTSDDLVSSAECSSDDEDFVECEPSTGGELVIPLLVEDPLATPPIATRAPSITLPPT
FRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGCDDDGLVISGYGSGETFDSNLPPTDDE
DFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTA
SSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANP
TEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETR
NYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgcacctgagaatccacgcgagacggagccctcctcgccggccggcctggacgcttggg
atctggttcctgttctggggatgtatcgtcagctctgtatggagttcttctaatgtagct
tcctcctcctccacctcttcctcgccggggtctcactctcagcacgagcaccatttccat
ggcagcaagcatcactcagtgcctatttctatctatcgttcccctgtttcccttcgagga
ggacacgctggcgctacgtacatctttgggaaaagtggtgggcttatcctctacacctgg
ccagccaatgacaggcccagcacgcggtctgaccgccttgccgtgggcttcagcaccact
gtgaaggatggcatcttggtccgcatcgacagtgctccaggacttggtgacttcctccag
cttcacatagaacaggggaaaattggagttgtcttcaacattggcacagttgacatctcc
atcaaagaggagagaacccctgtaaatgacggcaaataccatgtggtacgcttcaccagg
aacggcggcaacgccaccctgcaggtggacaactggccagtgaatgaacattatcctaca
ggccggcagttaaccatcttcaacactcaggcgcaaatagccattggtggaaaggacaaa
ggacgcctcttccaaggccaactctctgggctctattatgatggtttgaaagtactgaac
atggcggctgagaacaaccccaatattaaaatcaatggaagtgttcggctggttggagaa
gtcccatcaattttgggaacaacacagacgacctccatgccaccagaaatgtctactact
gtcatggaaaccactactacaatggcgactaccacaacccgtaagaatcgctctacagcc
agcattcagccaacatcagatgatcttgtttcatctgctgaatgttcaagtgatgatgaa
gactttgttgaatgtgagccgagtacaggaggtgaattagttatccctcttcttgtagaa
gaccctttagctacccctcctattgctactcgtgcaccttccattacactcccccctacc
tttcgccccctcctcaccattattgagaccaccaaagattccctgtccatgacctctgag
gcggggttaccttgcttgtcggaccaaggcagcgatggttgtgatgatgatggcttggtg
atatctgggtatggctcaggggaaacctttgactctaacctgccccctactgatgatgaa
gatttttacaccaccttctccttggtaacagataagagtctttccacttcaatcttcgaa
ggtggctacaaagcacatgcgcccaagtgggaatccaaggactttagacctaacaaagtc
tccgaaactagtaggactactaccacatctttatcccctgagctgatccgcttcacagct
tcctcctcgtctgggatggtgcccaaattgccagctggcaaaatgaataaccgtgatctc
aaaccccagcctgatatagtcttgcttccgttgcccactgcctatgagctagacagcacc
aaactgaagagcccactaattacttcccccatgttccgtaatgtgcccacagcaaacccc
acggagccgggaatcagacgggttccgggggcctcagaggtgatccgggagtcgagcagc
acaacagggatggtcgtcggcattgtggctgctgccgccctctgcatcttgatcctcctg
tacgccatgtacaagtacaggaacagggacgaggggtcctatcaagtggacgagacgcgg
aactacatcagcaactccgcccagagcaacggcacgctcatgaaggagaagcagcagagc
tcgaagagcggccacaagaaacagaaaaacaaggacagggagtattacgtgtaa

DBGET integrated database retrieval system