KEGG   Homo sapiens (human): 9370Help
Entry
9370              CDS       T01001                                 

Gene name
ADIPOQ, ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Definition
(RefSeq) adiponectin, C1Q and collagen domain containing
  KO
K07296  adiponectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Disease
H00967  Adiponectin deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    9370 (ADIPOQ)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    9370 (ADIPOQ)
   03320 PPAR signaling pathway
    9370 (ADIPOQ)
  09149 Aging
   04211 Longevity regulating pathway
    9370 (ADIPOQ)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    9370 (ADIPOQ)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9370 (ADIPOQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 9370
NCBI-ProteinID: NP_001171271
OMIM: 605441
HGNC: 13633
Ensembl: ENSG00000181092
Vega: OTTHUMG00000156521
Pharos: Q15848(Tbio)
CPD: C18189
UniProt: Q15848 A8K660 B2R773
Structure
PDB: 

Position
3q27.3
AA seq 244 aa AA seqDB search
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgctgggagctgttctactgctattagctctgcccggtcatgaccaggaaacc
acgactcaagggcccggagtcctgcttcccctgcccaagggggcctgcacaggttggatg
gcgggcatcccagggcatccgggccataatggggccccaggccgtgatggcagagatggc
acccctggtgagaagggtgagaaaggagatccaggtcttattggtcctaagggagacatc
ggtgaaaccggagtacccggggctgaaggtccccgaggctttccgggaatccaaggcagg
aaaggagaacctggagaaggtgcctatgtataccgctcagcattcagtgtgggattggag
acttacgttactatccccaacatgcccattcgctttaccaagatcttctacaatcagcaa
aaccactatgatggctccactggtaaattccactgcaacattcctgggctgtactacttt
gcctaccacatcacagtctatatgaaggatgtgaaggtcagcctcttcaagaaggacaag
gctatgctcttcacctatgatcagtaccaggaaaataatgtggaccaggcctccggctct
gtgctcctgcatctggaggtgggcgaccaagtctggctccaggtgtatggggaaggagag
cgtaatggactctatgctgataatgacaatgactccaccttcacaggctttcttctctac
catgacaccaactga

DBGET integrated database retrieval system