KEGG   Homo sapiens (human): 9371Help
Entry
9371              CDS       T01001                                 

Gene name
KIF3B, FLA8, HH0048, KLP-11
Definition
(RefSeq) kinesin family member 3B
  KO
K20196  kinesin family member 3B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9371 (KIF3B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     9371 (KIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Kinesin_assoc AAA_16
Motif
Other DBs
NCBI-GeneID: 9371
NCBI-ProteinID: NP_004789
OMIM: 603754
HGNC: 6320
Ensembl: ENSG00000101350
Vega: OTTHUMG00000032214
Pharos: O15066(Tbio)
UniProt: O15066
Structure
PDB: 

Position
20q11.21
AA seq 747 aa AA seqDB search
MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFD
AVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIP
NSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLS
SFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGK
LNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQE
EIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEK
LEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKN
IVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKK
LKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIM
NRAFFDEEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIRPEARYRAENI
VLLELDMPSRTTRDYEGPAIAPKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSG
RKSGSSSSSSGTPASQLYPQSRGLVPK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttgaaaagctcagagtcagtcagggtggtggttcgctgtcggcccatgaat
ggcaaggaaaaggctgcttcgtatgacaaagtggtggatgtggatgttaagctggggcag
gtgtctgtgaagaaccccaaagggacggcccatgaaatgcccaagaccttcacctttgat
gccgtctatgactggaatgccaagcagtttgaactgtacgatgagacgttccgaccactt
gttgactctgtcctgcaaggtttcaatggaaccatttttgcctatggacaaactgggaca
ggaaaaacctacaccatggaaggaatccgtggtgaccctgaaaaaagaggagtcattcct
aactcatttgaccatatcttcacccacatctctcgatcccagaatcaacaatacctggtc
agggcttcttacttagagatctaccaggaggagatccgagatttgctctcaaaggatcag
accaaaaggcttgagctcaaagagaggcctgacacaggagtgtatgtgaaagacctgtct
tcctttgtcaccaagagtgtgaaggagatagagcatgtgatgaatgtggggaaccagaac
cgttctgtcggtgctaccaacatgaacgagcacagctcgcgttctcatgcaattttcgtt
atcactattgagtgcagcgaggtgggcctcgatggtgaaaaccacatccgtgtaggaaaa
ttgaaccttgtagatcttgctggcagcgaacggcaagccaagaccggcgcacaaggggag
agattaaaagaagctaccaagatcaacctctccctttccgctttgggtaatgtcatctct
gctctagtggacggcaaaagcactcacattccatatcgggactcaaagcttaccaggctc
ctccaagattcccttggtggcaatgccaagactgtgatggtggccaacgtggggcctgcc
tcttacaacgtagaagagactctgaccactctgcgatatgccaaccgtgccaaaaacatt
aagaacaaaccaagggtcaatgaggaccccaaggatgccctccttcgagaattccaggaa
gagattgctcggctcaaggcccagctggaaaaacggtccattggtaggaggaagaggcga
gagaagcggagggaaggtggtggcagtggtgggggtggggaagaggaggaggaggaggga
gaagagggtgaggaggaaggggatgataaggatgattactggcgggaacagcaagaaaaa
ctggagattgagaagcgggccattgtagaggatcacagcttggttgcagaggagaagatg
aggctgctgaaggagaaagagaaaaagatggaggacctgcggcgggagaaggatgctgcc
gagatgctgggcgccaagatcaaggccatggagagtaagttgcttgttggaggaaaaaat
atagtagatcatacgaatgaacagcagaaaatcctggagcagaaacgacaggaaattgca
gagcagaaacgtcgagaaagagaaatccagcaacagatggaaagtcgagatgaggagacc
ttggaacttaaagagacatacagctcattgcagcaagaggtggacatcaagaccaaaaaa
ctcaaaaagctcttctccaagcttcaggcagtgaaggctgagatccatgacctccaagaa
gaacacatcaaggagcgccaagagctagagcagactcagaatgagctcaccagggagctg
aaactcaagcatcttattatagaaaactttatccctctggaagaaaaaagtaaaattatg
aatagagccttctttgatgaagaggaagatcattggaaactacatcctataaccagactg
gagaaccagcagatgatgaagcggccagtctcagccgtgggatataagagaccattgagc
cagcacgcaagaatgtccatgatgattcgtccagaggcccgatatagggcagaaaacatt
gtgctgttagagctggacatgcccagccggaccaccagagactatgagggtccagccatt
gcccccaaggtccaggctgcattggatgcggctctgcaggatgaagatgagatacaggtg
gatgcatcatcatttgaaagcactgcaaataagaaatccaaggccaggcctaaaagtgga
aggaagtcgggatcctcctcctcttcctcaggaacccctgcatctcagctttatccacag
tctcgggggctggttccaaagtaa

DBGET integrated database retrieval system