KEGG   Homo sapiens (human): 9372
Entry
9372              CDS       T01001                                 

Symbol
ZFYVE9, MADHIP, NSP, PPP1R173, SARA, SMADIP
Name
(RefSeq) zinc finger FYVE-type containing 9
  KO
K04679  MAD, mothers against decapentaplegic interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    9372 (ZFYVE9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9372 (ZFYVE9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9372 (ZFYVE9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9372 (ZFYVE9)
SSDB
Motif
Pfam: DUF3480 SARA FYVE
Other DBs
NCBI-GeneID: 9372
NCBI-ProteinID: NP_004790
OMIM: 603755
HGNC: 6775
Ensembl: ENSG00000157077
Vega: OTTHUMG00000008061
Pharos: O95405(Tbio)
UniProt: O95405
Structure
PDB: 
1DEV 5MJY 4BKW 1MK2

Position
1p32.3
AA seq 1425 aa
MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESA
VSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEIATMWIDENAVAEDQLIKRNY
SWDDQCSAVEVGEKKCGNLACLPDEKNVLVVAVMHNCDKRTLQNDLQDCNNYNSQSLMDA
FSCSLDNENRQTDQFSFSINESTEKDMNSEKQMDPLNRPKTEGRSVNHLCPTSSDSLASV
CSPSQLKDDGSIGRDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSP
RTDLGSPNSFSHMSEGILMKKEPAEESTTEESLRSGLPLLLKPDMPNGSGRNNDCERCSD
CLVPNEVRADENEGYEHEETLGTTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKE
KFLQISQPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDS
YGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNEATEGSGLLLNSTGD
LMKKNYLHNFCSQVPSVLGQSSPKVVASLPSISVPFGGARPKQPSNLKLQIPKPLSDHLQ
NDFPANSGNNTKNKNDILGKAKLGENSATNVCSPSLGNISNVDTNGEHLESYEAEISTRP
CLALAPDSPDNDLRAGQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHH
CRACGKVFCASCCSLKCKLLYMDRKEARVCVICHSVLMNAQAWENMMSASSQSPNPNNPA
EYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGAEVAQPREQRRVWFADGILPNGEV
ADAAKLTMNGTSSAGTLAVSHDPVKPVTTSPLPAETDICLFSGSITQVGSPVGSAMNLIP
EDGLPPILISTGVKGDYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNR
KCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVSNLGHSFF
SQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLMLRLGA
EYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIP
SNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGA
SFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEP
QEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLEND
DQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSN
GQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV
NT seq 4278 nt   +upstreamnt  +downstreamnt
atggagaattacttccaagcagaagcttacaacctggacaaggtgttagatgaatttgaa
caaaacgaagatgaaacagtttcttctactttattggatacaaagtggaataagattcta
gatcccccttctcaccggctgtcatttaaccctactttggccagtgtgaatgaatctgca
gtttctaatgagtcacaaccacaactgaaagtcttctccctggctcattcagctcccctg
accacagaggaagaggatcactgtgctaatggacaggactgtaatctaaatccagagatt
gccacaatgtggattgatgaaaatgctgttgcagaagaccagttaattaagagaaactat
agttgggatgatcaatgcagtgctgttgaagtgggagagaagaaatgtggaaacctggct
tgtctgccagatgagaagaatgttcttgttgtagccgtcatgcataactgtgataaaagg
acattacaaaacgatttacaggattgtaataattataatagtcaatcccttatggatgct
tttagctgttcactggataatgaaaacagacaaactgatcaatttagttttagtataaat
gagtccactgaaaaagatatgaattcagagaaacaaatggatccattgaatagaccgaaa
acagaggggagatctgttaaccatctgtgtcctacttcatctgatagtctagccagtgtc
tgttccccttcacaattaaaggatgacggaagtataggtagagacccctccatgtctgcg
attacaagtttaacggttgattcagtaatctcatcccagggaacagatggatgtcctgct
gttaaaaagcaagagaactatataccagatgaggacctcactggcaaaatcagctctcct
aggacagatctagggagtccaaattccttttcccacatgagtgaggggattttgatgaaa
aaagagccagcagaggagagcaccactgaagaatccctccggtctggtttacctttgctt
ctcaaaccagacatgcctaatgggtctggaaggaataatgactgtgaacggtgttcagat
tgccttgtgcctaatgaagttagggctgatgaaaatgaaggttatgaacatgaagaaact
cttggcactacagaattccttaatatgacagagcatttctctgaatctcaggacatgact
aattggaagttgactaaactaaatgagatgaatgatagccaagtaaacgaagaaaaggaa
aagtttctacagattagtcagcctgaggacactaatggtgatagtggaggacagtgtgtt
ggattggcagatgcaggtctagatttaaaaggaacttgcattagtgaaagtgaagaatgt
gatttctccactgttatagacacaccagcagcaaattatctatctaatggttgtgattcc
tatggaatgcaagacccaggtgtttcttttgttccaaagactttaccctccaaagaagat
tcagtaacagaagaaaaagaaatagaggaaagcaagtcagaatgctactcaaatatttat
gaacagagaggaaatgaggccacagaagggagtggactacttttaaacagcactggtgac
ctaatgaagaaaaattatttacataatttctgtagtcaagttccatcagtgcttgggcaa
tcttcccccaaggtagtagcaagcctgccatctatcagtgttccttttggtggtgcaaga
cccaagcaaccttctaatcttaaacttcaaattccaaagccattatcagaccatttacaa
aatgactttcctgcaaacagtggaaataatactaaaaataaaaatgatattcttgggaaa
gcaaaattaggggaaaactcagcaaccaatgtatgcagtccatctttgggaaacatctct
aatgtcgatacaaatggggaacatttagaaagttatgaggctgagatctccactagacca
tgccttgcattagctccagatagcccagataatgatctcagagctggtcagtttggaatt
tctgccagaaagccattcaccactctgggtgaggtggctccagtatgggtaccggattct
caggctccaaattgcatgaaatgtgaagccaggtttacattcaccaaaaggaggcatcac
tgcagagcatgtgggaaggttttctgtgcttcctgctgtagcctgaaatgtaaactgtta
tacatggacagaaaggaagctagagtgtgtgtaatctgccattcagtgctaatgaatgct
caagcctgggagaacatgatgagtgcctcaagccagagccctaaccctaacaatcctgct
gaatactgttctactatccctcccttgcagcaagctcaggcctcaggagctctgagctct
ccacctcccactgtgatggtacctgtgggagttttaaagcaccctggagcagaagtggct
cagcccagagagcagaggcgagtttggtttgctgatgggatcttgcccaatggagaagtt
gctgatgcagccaaattaacaatgaatggaacttcctctgcaggaaccctggctgtgtca
cacgacccagtcaagccagtaactaccagtcctctaccagcagagacggatatttgtcta
ttctctgggagtataactcaggttggaagtcctgttggaagtgcaatgaatcttattcct
gaagatggccttcctcccattctcatctccactggtgtaaaaggagactatgctgtggaa
gagaaaccatcacagatttcagtaatgcagcagttggaggatggtggccctgacccactt
gtatttgttttaaatgcaaatttgttgtcaatggttaaaattgtaaattatgtgaacagg
aagtgctggtgtttcacaaccaagggaatgcatgcagtgggtcagtctgagatagtcatt
cttctacagtgtttaccggatgaaaagtgtttgccaaaggatatctttaatcactttgtg
cagctttatcgggatgctctggcagggaatgtggtgagcaacttgggacattccttcttc
agtcaaagtttccttggcagtaaagaacatggtggattcttatatgtgacatctacctac
cagtcactgcaagacctagtactcccaaccccaccttacttgtttgggattcttatccag
aaatgggaaactccttgggctaaagtatttcctatccgtctgatgttgagacttggagct
gaatatcgactttatccatgcccactattcagtgtcagatttcggaagccattgtttgga
gagacggggcataccatcatgaatcttcttgcagacttcagaaattaccagtataccttg
ccagtagttcaaggtttggtggttgatatggaagttcggaaaactagcatcaaaattccc
agcaacagatacaatgagatgatgaaagccatgaacaagtccaatgagcatgtcctggca
ggaggtgcctgcttcaatgaaaaggcagactctcatcttgtgtgtgtacagaatgatgat
ggaaactatcagacccaggctatcagtattcacaatcagcccagaaaagtgactggtgcc
agtttctttgtgttcagtggcgctctgaaatcctcttctggataccttgccaagtccagt
attgtggaagatggtgttatggtccagattactgcagagaacatggattccttgaggcag
gcactgcgagagatgaaggacttcaccatcacctgtgggaaggcggacgcggaggaaccc
caggagcacatccacatccagtgggtggatgatgacaagaacgttagcaagggtgtcgta
agtcctatagatgggaagtccatggagactataacaaatgtgaagatattccatggatca
gaatataaagcaaatggaaaagtaatcagatggacagaggtgtttttcctagaaaacgat
gaccagcacaattgcctcagtgatcctgcagatcacagtagattgactgagcatgttgcc
aaagctttttgccttgctctctgtcctcacctgaaacttctgaaggaagatggaatgacc
aaactgggactacgtgtgacacttgactcagatcaggttggctatcaagcagggagcaat
ggccagccccttccctcgcagtacatgaatgatctggacagcgccttggtgccggtgatc
catggaggggcctgccagcttagtgagggccccgttgtcatggaactcatcttttatatt
ctggaaaacatcgtataa

KEGG   Homo sapiens (human): 9765
Entry
9765              CDS       T01001                                 

Symbol
ZFYVE16, PPP1R69
Name
(RefSeq) zinc finger FYVE-type containing 16
  KO
K04679  MAD, mothers against decapentaplegic interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    9765 (ZFYVE16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9765 (ZFYVE16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9765 (ZFYVE16)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9765 (ZFYVE16)
SSDB
Motif
Pfam: FYVE
Other DBs
NCBI-GeneID: 9765
NCBI-ProteinID: NP_001271166
OMIM: 608880
HGNC: 20756
Ensembl: ENSG00000039319
Vega: OTTHUMG00000108178
Pharos: Q7Z3T8(Tbio)
UniProt: Q7Z3T8
Structure
PDB: 
3T7L 5MK0

Position
5q14.1
AA seq 809 aa
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQ
ECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGLDLLSSVDGGTSDEIQPLYMG
RCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREQQNDISSELQNREIGGIKELGIKVDTTLSDSYNYSGTENLKDKKIFNQLESIV
DFNMSSALTRQSSKMFHAKDKLQHKSQPCGLLKDVGLVKEEVDVAVITAAECLKEEGKTS
ALTCSLPKNEDLCLNDSNSRDENFKLPDFSFQEDKTVIKQSAQEDSKSLDLKDNDVIQDS
SSALHVSSKDVPSSLSCLPASGSMCGSLIESKARGDFLPQHEHKDNIQDAVTIHEEIQNS
VVLGGEPFKENDLLKQEKCKSILLQSLIEGMEDRKIDPDQTVIRAESLDGGDTSSTVVES
QEGLSGTHVPESSDCCEGFINTFSSNDMDGQDLDYFNIDEGAKSGPLISDAELDAFLTEQ
YLQTTNIKSFEENVNDSKSQMNQIDMKGLDDGNINNIYFNAEAGAIGESHGINIICEIVD
KQNTIENGLSLGEKSTIPVQQGLPTSKSEITNQLSVSDINSQSVGGARPKQLFSLPSRTR
SSKDLNKPDVPDTIESEPSTADTVVPITCAIDSTADPQVSFNSNYIDIESNSEGGSSFVT
ANEDSVPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGVC
CNRKCKLQYLEKEARVCVVCYETISKGEY
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggacagttattttaaagcagctgtcagtgacttggacaaactccttgatgattttgaa
cagaacccagatgaacaagattatctccaagatgtacaaaatgcatatgattctaaccac
tgctcagtttcttcagagttggcttcctcacagcgaacttcattgctcccaaaagaccaa
gagtgcgttaatagttgtgcctcatcagaaacaagctatggaacaaatgagagttccctg
aatgaaaaaacactcaagggacttacttctatacaaaatgaaaaaaatgtaacaggactt
gatcttctttcttctgtggatggtggtacttcagatgaaatccagccgttatatatggga
cgatgtagtaaacctatctgtgatctgataagtgacatgggtaacttagttcatgcaacc
aatagtgaagaagatattaaaaaattattgccagatgattttaagtctaatgcagattcc
ttgattggattggatttatcttcagtgtcagatactccctgtgtttcttcaacagaccat
gatagtgatactgtcagagaacaacagaatgatatcagttctgaattacaaaatagagaa
atcggaggaatcaaagaattgggtataaaagtagatacaacactttcagattcctataat
tacagtggaacagaaaatttaaaagataaaaagatctttaatcagttagaatcaattgtt
gattttaacatgtcatctgctttgactcgacaaagttccaaaatgtttcatgccaaagac
aagctacaacacaagagccagccatgtggattactaaaagatgttggcttagtaaaagag
gaagtagatgtggcagtcataactgccgcagaatgtttaaaagaagagggcaagacaagt
gctttgacctgcagccttccgaaaaatgaagatttatgcttaaatgattcaaattcaaga
gatgaaaatttcaaattacctgacttttcctttcaggaagataagactgttataaaacaa
tctgcacaagaagactcaaaaagtttagaccttaaggataatgatgtaatccaagattcc
tcttcagctttacatgtttccagtaaagatgtgccgtcctcattgtcctgtcttcctgcg
tctgggtctatgtgtggatcattaattgaaagtaaagcacggggtgattttttacctcag
catgaacataaagataatatacaagatgcagtgactatacatgaagaaatacagaacagt
gttgttctaggtggggaaccattcaaagagaatgatcttttgaaacaggaaaaatgtaaa
agcatactccttcagtcattaattgaagggatggaagacagaaagatagatcctgaccag
acagtaatcagagctgagtctttggatggtggtgacaccagttctacagttgtagaatct
caagaggggctttctggcactcatgtcccagagtcttctgattgttgtgaaggttttatt
aatactttttcaagcaatgatatggatgggcaagacttagattactttaatattgatgaa
ggcgcaaaaagtggcccactaattagtgatgctgaacttgatgcctttctgacagaacag
tatcttcagaccactaacataaagtcttttgaagaaaatgtaaatgactctaaatcgcaa
atgaatcagatagatatgaaaggcttagatgatggaaacatcaataatatatatttcaat
gcagaagcaggagctattggggaaagtcatggtattaatataatttgtgaaatagttgat
aaacaaaatacaatagaaaatggcctttctttaggagaaaaaagcactattccagttcaa
caagggttacctaccagtaagtctgagattacaaatcaattatcggtctctgatattaac
agtcaatctgttggaggggccagacctaagcaattgtttagccttccatcaagaacaagg
agttcaaaggacctgaataagccagatgttccagatacaatagaaagtgaacccagcaca
gcagataccgttgttccaatcacttgtgctatagattctacagctgatccacaggttagc
ttcaactctaattacattgatatagaaagtaattctgaaggtggatctagtttcgtaact
gcaaatgaagattctgtacctgaaaacacttgcaaagaaggcttggttttgggccagaaa
cagcctacttgggttcctgattcagaagctccaaactgtatgaactgccaagtcaaattt
acttttaccaaacggcgacaccattgccgagcatgtgggaaagtattttgtggtgtctgt
tgtaataggaagtgtaaactgcaatatctagaaaaggaagcaagagtatgtgtagtctgc
tatgaaactattagtaaaggtgagtattaa

DBGET integrated database retrieval system