KEGG   Homo sapiens (human): 9373Help
Entry
9373              CDS       T01001                                 

Gene name
PLAA, DOA1, NDMSBA, PLA2P, PLAP
Definition
(RefSeq) phospholipase A2 activating protein
  KO
K14018  phospholipase A-2-activating protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9373 (PLAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PUL PFU WD40
Motif
Other DBs
NCBI-GeneID: 9373
NCBI-ProteinID: NP_001026859
OMIM: 603873
HGNC: 9043
Ensembl: ENSG00000137055
Vega: OTTHUMG00000019708
Pharos: Q9Y263(Tchem)
UniProt: Q9Y263
Structure
PDB: 

Position
9p21.2
AA seq 795 aa AA seqDB search
MTSGATRYRLSCSLRGHELDVRGLVCCAYPPGAFVSVSRDRTTRLWAPDSPNRSFTEMHC
MSGHSNFVSCVCIIPSSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKNTVCSLSS
GKFGTLLSGSWDTTAKVWLNDKCMMTLQGHTAAVWAVKILPEQGLMLTGSADKTVKLWKA
GRCERTFSGHEDCVRGLAILSETEFLSCANDASIRRWQITGECLEVYYGHTNYIYSISVF
PNCRDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLDNGDIVVGASDGIIRVFTES
EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGE
KVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPY
NTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNPSFSDPFTGGGRYVPG
SSGSSNTLPTADPFTGAGRYVPGSASMGTTMAGVDPFTGNSAYRSAASKTMNIYFPKKEA
VTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILW
KAINCPEDIVFPALDILRLSIKHPSVNENFCNEKEGAQFSSHLINLLNPKGKPANQLLAL
RTFCNCFVGQAGQKLMMSQRESLMSHAIELKSGSNKNIHIALATLALNYSVCFHKDHNIE
GKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSE
PAKVSECCRFILNLL
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcggcgcaaccaggtaccggctgagctgctcgctccggggccacgagctggac
gtacggggcctggtgtgctgcgcctatccgccgggagcctttgtgtccgtgtcccgagac
cgcaccacccgcctctgggccccagacagtccaaacaggagctttacagaaatgcactgt
atgagtggccattccaattttgtatcttgtgtatgcatcataccctcaagtgacatctac
cctcatggcctaattgccaccggtggaaatgaccacaatatatgcattttctcactggac
agtccaatgccactttatattctaaaaggccacaaaaatactgtttgtagtctatcatct
ggaaaatttgggacattacttagtggttcatgggacaccactgctaaagtctggctgaat
gacaagtgcatgatgaccttgcagggtcatacagctgcagtgtgggcggtaaagatctta
cctgaacagggcttaatgttgactggatcagcagacaagactgttaaactgtggaaggct
ggaagatgtgagaggactttttcagggcatgaagactgtgtaagaggtttggcaattttg
agtgaaacagaatttctttcctgtgcaaatgatgctagtattagaaggtggcaaatcact
ggcgagtgtcttgaagtatattatggacatacaaattatatttatagcatatccgttttt
ccaaattgtagagactttgtgacaacagcagaggacagatctctgagaatctggaaacat
ggggaatgtgctcaaactatccgacttccagctcagtctatatggtgctgctgtgtgctc
gacaatggtgacattgtggttggtgcgagtgatggcattattagagtgtttacagaatca
gaagatcgaacagcaagtgctgaagaaatcaaggcttttgaaaaagaactgtctcacgca
accattgattctaaaactggcgatttaggggacatcaatgctgagcagcttcctgggagg
gaacatcttaatgaacctggtactagagaaggacagactcgtctaatcagagatggggag
aaagtcgaagcctatcagtggagtgttagtgaagggaggtggataaaaattggtgatgtt
gttggctcatctggtgctaatcagcaaacatctggaaaagttttatatgaagggaaagaa
tttgattatgttttctcaattgatgtcaatgaaggtggaccatcatataaattgccatat
aataccagtgatgacccttggttaactgcatacaacttcttacagaagaatgatttgaat
cctatgtttctggatcaagtagctaaatttattattgataacacaaaaggtcaaatgttg
ggacttgggaatcccagcttttcagatccatttacaggtggtggtcggtatgttccgggc
tcttcgggatcttctaacacactacccacagcagatccttttacaggtgctggtcgttat
gtaccaggttctgcaagtatgggaactaccatggccggagttgatccatttacagggaat
agtgcctaccgatcagctgcatctaaaacaatgaatatttatttccctaaaaaagaggct
gtcacatttgaccaagcaaaccctacacaaatattaggtaaactgaaggaacttaatgga
actgcacctgaagagaagaagttaactgaggatgacttgatacttcttgagaagatactg
tctctaatatgtaatagttcttcagaaaaacccacagtccagcaacttcagattttgtgg
aaagctattaactgtcctgaagatattgtctttcctgcacttgacattcttcggttgtca
attaaacaccccagtgtgaatgagaacttctgcaatgaaaaggaaggggctcagttcagc
agtcatcttatcaatcttctgaaccctaaaggaaagccagcaaaccagctgcttgctctc
aggactttttgcaattgttttgttggccaggcaggacaaaaactcatgatgtcccagagg
gaatcactgatgtcccatgcaatagaactgaaatcagggagcaataagaacattcacatt
gctctggctacattggccctgaactattctgtttgttttcataaagaccataacattgaa
gggaaagcccaatgtttgtcactaattagcacaatcttggaagtagtacaagacctagaa
gccacttttagacttcttgtggctcttggaacacttatcagtgatgattcaaatgctgta
caattagccaagtctttaggtgttgattctcaaataaaaaagtattcctcagtatcagaa
ccagctaaagtaagtgaatgctgtagatttatcctaaatttgctgtag

DBGET integrated database retrieval system