KEGG   Homo sapiens (human): 9375Help
Entry
9375              CDS       T01001                                 

Gene name
TM9SF2, P76
Definition
(RefSeq) transmembrane 9 superfamily member 2
  KO
K17086  transmembrane 9 superfamily member 2/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9375 (TM9SF2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9375 (TM9SF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP70
Motif
Other DBs
NCBI-GeneID: 9375
NCBI-ProteinID: NP_004791
OMIM: 604678
HGNC: 11865
Ensembl: ENSG00000125304
Vega: OTTHUMG00000017272
Pharos: Q99805(Tdark)
UniProt: Q99805 A0A024QYR8
Position
13q32.3
AA seq 663 aa AA seqDB search
MSARLPVLSPPRWPRLLLLSLLLLGAVPGPRRSGAFYLPGLAPVNFCDEEKKSDECKAEI
ELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETC
KLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPI
GCYITDKGHAKDACVISSDFHERDTFYIFNHVDIKIYYHVVETGSMGARLVAAKLEPKSF
KHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDDKIRWASRWDYILESMPHTHIQ
WFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKLVHGDIFRPPR
KGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAAR
FYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCI
SVPLTFIGAYFGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLF
FILNSIWSHQMYYMFGFLFLVFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTA
VYFLIYAVHYFFSKLQITGTASTILYFGYTMIMVLIFFLFTGTIGFFACFWFVTKIYSVV
KVD
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaggctgccggtgttgtctccacctcggtggccgcggctgttgctgctgtcg
ctgctcctgctgggggcggttcctggcccgcgccggagcggcgctttctacctgcccggc
ctggcgcccgtcaacttctgcgacgaagaaaaaaagagcgacgagtgcaaggccgaaata
gaactatttgtgaacagacttgattcagtggaatcagttcttccttatgaatacacagcg
tttgatttttgccaagcatcagaaggaaagcgcccatctgaaaatcttggtcaggtacta
ttcggggaaagaattgaaccttcaccatataagtttacgtttaataagaaggagacctgt
aagcttgtttgtacaaaaacataccatacagagaaagctgaagacaaacaaaagttagaa
ttcttgaaaaaaagcatgttattgaattatcaacatcactggattgtggataatatgcct
gtaacgtggtgttacgatgttgaagatggtcagaggttctgtaatcctggatttcctatt
ggctgttacattacagataaaggccatgcaaaagatgcctgtgttattagttcagatttc
catgaaagagatacattttacatcttcaaccatgttgacatcaaaatatactatcatgtt
gttgaaactgggtccatgggagcaagattagtggctgctaaacttgaaccgaaaagcttc
aaacatacccatatagataaaccagactgctcagggccccccatggacataagtaacaag
gcttctggggagataaaaattgcctatacttactctgttagcttcgaggaagatgataag
atcagatgggcgtctagatgggactatattctggagtctatgcctcatacccacattcag
tggtttagcattatgaattccctggtcattgttctcttcttatctggaatggtagctatg
attatgttacggacactgcacaaagatattgctagatataatcagatggactctacggaa
gatgcccaggaagaatttggctggaaacttgttcatggtgatatattccgtcctccaaga
aaagggatgctgctatcagtctttctaggatccgggacacagattttaattatgaccttt
gtgactctatttttcgcttgcctgggatttttgtcacctgccaaccgaggagcgctgatg
acgtgtgctgtggtcctgtgggtgctgctgggcacccctgcaggctatgttgctgccaga
ttctataagtcctttggaggtgagaagtggaaaacaaatgttttattaacatcatttctt
tgtcctgggattgtatttgctgacttctttataatgaatctgatcctctggggagaagga
tcttcagcagctattccttttgggacactggttgccatattggccctttggttctgcata
tctgtgcctctgacgtttattggtgcatactttggttttaagaagaatgccattgaacac
ccagttcgaaccaatcagattccacgtcagattcctgaacagtcgttctacacgaagccc
ttgcctggtattatcatgggagggattttgccctttggctgcatctttatacaacttttc
ttcattctgaatagtatttggtcacaccagatgtattacatgtttggcttcctatttctg
gtgtttatcattttggttattacctgttctgaagcaactatacttctttgctatttccac
ctatgtgcagaggattatcattggcaatggcgttcattccttacgagtggctttactgca
gtttatttcttaatctatgcagtacactacttcttttcaaaactgcagatcacgggaaca
gcaagcacaattctgtactttggttataccatgataatggttttgatcttctttcttttt
acaggaacaattggcttctttgcatgcttttggtttgttaccaaaatatacagtgtggtg
aaggttgactga

DBGET integrated database retrieval system