KEGG   Homo sapiens (human): 9378Help
Entry
9378              CDS       T01001                                 

Gene name
NRXN1, Hs.22998, PTHSL2, SCZD17
Definition
(RefSeq) neurexin 1
  KO
K07377  neurexin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00756  Pitt-Hopkins syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    9378 (NRXN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9378 (NRXN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9378 (NRXN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_G_1 Syndecan DUF202 Laminin_G_3 CD34_antigen
Motif
Other DBs
NCBI-GeneID: 9378
NCBI-ProteinID: NP_001317021
OMIM: 600565
HGNC: 8008
Ensembl: ENSG00000179915
Vega: OTTHUMG00000129263
Pharos: Q9ULB1(Tbio)
UniProt: P58400
Structure
PDB: 

Position
2p16.3
AA seq 472 aa AA seqDB search
MYQRMLRCGAELGSPGGGGGGGGGGGAGGRLALLWIVPLTLSGLLGVAWGASSLGAHHIH
HFHGSSKHHSVPIAIYRSPASLRGGHAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIG
FSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVV
RFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTI
FNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMT
TESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDI
DPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKY
RNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagaggatgctccggtgcggcgccgagctgggctcgcccgggggcggcggcggc
ggcggcggcggcggcggcgcaggggggcgcctggccctgctttggatagtcccgctcacc
ctcagcggcctcctaggagtggcgtggggggcatccagtttgggagcgcaccacatccac
catttccatggcagcagcaagcatcattcagtgcctattgcaatctacaggtcaccggca
tccttgcgaggcggacacgctgggacgacatatatctttagcaaaggtggtggacaaatc
acgtataagtggcctcctaatgaccgacccagtacacgagcagacagactggccataggt
tttagcactgttcagaaagaagccgtattggtgcgagtggacagttcttcaggcttgggt
gactacctagaactgcatatacaccagggaaaaattggagttaagtttaatgttgggaca
gatgacatcgccattgaagaatccaatgcaatcattaatgatgggaaataccatgtagtt
cgtttcacgaggagtggtggcaatgccacgttgcaggtggacagctggccagtgatcgag
cgctaccctgcaggaaacaatgataacgagcgcctggcgattgctagacagcgaattcca
tatcgacttggtcgagtagttgatgaatggctactcgacaaagggcgtcagctcacaatc
ttcaatagccaagcaaccataataattggcgggaaagagcagggccagcccttccagggc
cagctctctgggctgtactacaatggcttgaaagttctgaatatggcagccgaaaacgat
gccaacatcgccatagtgggaaatgtgagactggttggtgaagtgccttcctctatgaca
actgagtcaacagccactgccatgcaatcagagatgtccacatcaattatggagactacc
acgaccctggctactagcacagccagaagaggaaagcccccgacaaaagaacccattagc
cagaccacagatgacatccttgtggcctcagcagagtgtcccagcgatgatgaggacatt
gacccctgtgagccgagctcaggtgggttagccaacccaacccgagcaggcggcagagag
ccgtatccaggctcagcagaagtgatccgggagtccagcagcaccacgggtatggtcgtt
gggatagtagccgctgccgccctgtgcatccttatcctcctctatgccatgtacaagtac
agaaaccgggatgaaggctcataccatgtggacgagagtcgaaactacatcagtaactca
gcacagtccaatggggctgttgtaaaggagaaacaacccagcagtgcgaaaagctccaac
aaaaataagaaaaacaaggataaagagtattatgtctga

DBGET integrated database retrieval system