KEGG   Homo sapiens (human): 9382
Entry
9382              CDS       T01001                                 

Gene name
COG1, CDG2G, LDLB
Definition
(RefSeq) component of oligomeric golgi complex 1
  KO
K20288  conserved oligomeric Golgi complex subunit 1
Organism
hsa  Homo sapiens (human)
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9382 (COG1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    9382 (COG1)
SSDB
Motif
Pfam: Vps51 DUF3510
Other DBs
NCBI-GeneID: 9382
NCBI-ProteinID: NP_061184
OMIM: 606973
HGNC: 6545
Ensembl: ENSG00000166685
Vega: OTTHUMG00000178344
Pharos: Q8WTW3(Tbio)
UniProt: Q8WTW3
Position
17q25.1
AA seq 980 aa
MATAATSPALKRLDLRDPAALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLI
EAADTIGQMRRCAVGLVDAVKATDQYCARLRQAGSAAPRPPRAQQPQQPSQEKFYSMAAQ
IKLLLEIPEKIWSSMEASQCLHATQLYLLCCHLHSLLQLDSSSSRYSPVLSRFPILIRQV
AAASHFRSTILHESKMLLKCQGVSDQAVAEALCSIMLLEESSPRQALTDFLLARKATIQK
LLNQPHHGAGIKAQICSLVELLATTLKQAHALFYTLPEGLLPDPALPCGLLFSTLETITG
QHPAGKGTGVLQEEMKLCSWFKHLPASIVEFQPTLRTLAHPISQEYLKDTLQKWIHMCNE
DIKNGITNLLMYVKSMKGLAGIRDAMWELLTNESTNHSWDVLCRRLLEKPLLFWEDMMQQ
LFLDRLQTLTKEGFDSISSSSKELLVSALQELESSTSNSPSNKHIHFEYNMSLFLWSESP
NDLPSDAAWVSVANRGQFASSGLSMKAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSDD
SSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQ
DALNSAKLHSVLFMARLCQSLGELCPHLKQCILGKSESSEKPAREFRALRKQGKVKTQEI
IPTQAKWQEVKEVLLQQSVMGYQVWSSAVVKVLIHGFTQSLLLDDAGSVLATATSWDELE
IQEEAESGSSVTSKIRLPAQPSWYVQSFLFSLCQEINRVGGHALPKVTLQEMLKSCMVQV
VAAYEKLSEEKQIKKEGAFPVTQNRALQLLYDLRYLNIVLTAKGDEVKSGRSKPDSRIEK
VTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHN
ILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQVVPPARSTAGDPTVPGSLFRQLVSE
EDNTSAPSLFKLGWLSSMTK
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggccaccgcggcaacctcacccgcgctgaagcggctggatctgcgcgaccctgcggct
cttttcgagacgcatggagcggaggagatccgcgggctggagcgccaggttcgggccgag
atcgagcacaagaaggaggagctgcggcagatggtgggcgaacggtaccgcgacctgatc
gaggcggccgacaccatcggccagatgcgccgctgcgccgtggggctagtggacgccgtg
aaggccaccgaccagtactgcgcccgcctccgccaggccggctcggccgcgccccggcca
ccgcgggcccagcagccacagcagccatcccaggagaagttctacagcatggctgcccag
atcaagctactcttagaaattccggagaagatctggagctcgatggaagcctctcagtgt
ctccacgccacacagctctacctgctctgctgccacctccacagcctgctccagctggat
tcttctagttcccgatacagtcccgtcctctcccggtttcctatactcatccggcaggtg
gcagccgccagccacttccggtcaactattctgcatgaaagcaagatgttgctcaaatgc
caaggtgtgtctgaccaagctgtggccgaggccctgtgctctataatgctcttagaagag
agttctcctcgccaagccctcacagacttcctgctggccagaaaggcaactattcagaaa
cttctcaaccagccacaccatggtgctggtatcaaggctcagatttgctcattagtggag
ttgctggccaccactctgaagcaagctcatgcccttttctacactttgccagaaggactg
ctgccagatccagccctgccatgtggcttgctcttctctactctggagaccatcacaggc
cagcatcctgccggaaagggcactggtgtcctgcaggaagagatgaaactctgcagctgg
tttaaacacctgccagcatccatcgtcgagttccagccaacactccgaacccttgcacat
cccatcagtcaggaatacctgaaagacacgctgcagaaatggatccacatgtgtaatgaa
gacattaaaaatgggatcaccaacctgctcatgtacgtgaagagcatgaagggtctcgcg
ggaatccgggacgccatgtgggagttacttaccaatgagtccaccaatcacagctgggat
gtgctatgtcggcggcttctggagaagccgctcttgttctgggaagatatgatgcagcaa
ctgttccttgaccgattacagactctgacaaaagaaggctttgactccatctccagtagc
tccaaggagctcttggtttcagctttgcaggaacttgaaagcagcaccagcaactcccct
tcaaataagcacatccactttgagtacaacatgtcgctcttcctctggtctgagagtcct
aatgacctgccttccgatgcggcctgggtcagcgtggcaaaccggggtcagtttgccagt
agcggcctctccatgaaagcacaagccatcagcccttgtgtacagaacttctgttctgcc
ctggattctaagctgaaggttaaactagatgacctcctggcttacctcccctctgatgac
tcatcactgcccaaggacgtttctcccacacaggccaagagttctgcctttgacagatac
gcagatgcggggaccgtgcaggagatgctgcggactcagtccgtggcatgcatcaagcac
atcgtggactgcatccgggcagagctacagagcattgaagagggtgtgcaagggcaacag
gatgccctcaacagtgccaagctgcactcagttcttttcatggccagactctgccagtcc
ctgggagagctgtgcccccatctgaagcagtgcatcctgggaaaatcagagagctcagag
aaaccagcaagggagtttagggctctgagaaaacagggaaaggtgaaaactcaggaaatc
attcctacacaggccaagtggcaagaggttaaagaagtactcctccagcagagcgtgatg
ggctaccaggtctggagcagtgcagttgtgaaagttttgattcatggattcacccagtca
ttacttctagatgatgctggctcagttctggccacagccaccagctgggatgagctagaa
attcaggaggaggcagagtctggcagcagtgtcacatccaagatccgactccctgcacag
ccgtcctggtatgtacagtccttcctgtttagtttatgccaggaaattaatcgggttgga
ggccatgccttgccaaaggtgacattacaggagatgctgaaaagctgtatggttcaagta
gtagctgcctatgagaaactctccgaagaaaaacagattaagaaagaaggtgcatttcca
gtcacccagaaccgggcgctgcagctgctttatgatctgcgttacctcaacattgttctg
acagccaagggtgacgaggtgaagagtggccggagcaagccagactccagaattgagaaa
gtgactgaccacctggaagccctcattgatccatttgacctggacgttttcacgccacac
ctcaacagcaaccttcatcgcctggtgcagcgaacttctgttctgtttggattggtgact
ggtacagagaatcagctcgccccccggagcagtacgttcaactcccaagaaccccataac
atcctgccactggcatccagtcagatcaggtttggacttctcccactgagcatgacaagc
actcgaaaggctaaatcaaccagaaacatcgaaacaaaagctcaggttgtccccccggca
cgctccacagctggtgacccgacagttcctggctccttgttcagacagcttgtcagtgaa
gaagacaacacgtctgcaccttcattattcaaacttggctggctctctagtatgactaag
taa

DBGET integrated database retrieval system